Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Skeletal Muscle Relaxants > LL-37 for Sale > Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply
Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply buy - large image1
Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply buy - image1
Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply buy - image2
Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply buy - image3
Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply buy - image4
Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply buy - image5
Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply buy - image6

Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply

TDS 1 Inquiries

Unit Price:

$1/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

hongkong

Brand:

Customization Available

Packaging:

10 bottles per box

Price valid (until):

2026-07-11

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


     whatsapp+85244209880  


    ghjkl202620@outlook.com


    Product selection process Service Customer Process
    COR20 PA20 CH20 OV20 CGL5 CGL10 MAZ5 MAZ10 SUR5 SUR10 10 bottles per box
    Payment ways chosen Please choose one of the payment way you preferred.
    Our payment ways: Bank wire, Wise
    After payment Please offer shipping address after payment for shipment.
    Tracking We will provide the tracking after goods sent
    Lead time About 1-5 working days after payment
    Shipping time About 8-15 days door to door
    After-sale service Available always
    Shop Peptide Factory, High PurityCortagen 20mg pancragen  chonluten ovagen cagrilintide mazdutide  survodutide-Detailed Image 1
    Shop Peptide Factory, High PurityCortagen 20mg pancragen  chonluten ovagen cagrilintide mazdutide  survodutide-Detailed Image 2

    Pls input...

    Our company specializes in exporting various chemical products, including chemical raw materials, a full range of peptide products, and cosmetic raw materials.

    We will provide you with high quality products at the best offer. Professional transportation, convenient and safe, door-to-door delivery.

      Customers who have ordered our products(peptides)have had very good feedback.

    World wide relaible buyers can contact us about the peptides.


    What is Retatrutide?


    Retatrutide showed glucose control and weight loss in patients with type 2 diabetes mellitus (T2DM).Retatrutide (LY3437943) glucosedependent polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor . Retatrutide can be used for the research of obesity.Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides. Retatrutide is a new weight loss drug being experimented on by Eli Lilly, a pharmaceutical giant renowned for its breakthrough in diabetes and obesity treatment. Much like other weight loss drugs rolled out by Eli Lilly, Retatrutide has yielded exceptional results in treating chronic diseases like diabetes and obesity compared to the predecessors.

    Function

    1. 1.Treatment of depression and anxiety disorders:  Retatrutide has been shown to have antidepressant and anxiolytic effects in preclinical studies, suggesting that it could be a promising treatment option for individuals with these conditions.
    2. 2.Prevention of neurodegenerative diseases:  Retatrutide  has neuroprotective properties that may be useful in preventing or slowing the progression of neurodegenerative diseases such as Alzheimer's and Parkinson's.
    3. 3.Enhancement of cognitive function:  Retatrutide has been shown to improve learning and memory in animal studies, suggesting that it could have potential as a cognitive enhancer in humans.
    4. 4.Treatment of chronic pain: Retatrutide has been shown to have analgesic effects in preclinical studies, suggesting that it could be a useful treatment option for individuals with chronic pain conditions.
    5. 5.Promotion of wound healing:  Retatrutide  has been shown to accelerate wound healing in animal studies, suggesting that it could have potential as a therapeutic agent for promoting wound healing in humans.

    Application

    1. Retatrutide is often used in the pharmaceutical industry, weight losing, etc.
    2. Retatrutide is a kind of peptide product.
    3. Retatrutide acetate can inhibited GCGR, GIPR and GLP-1R.
    4. Retatrutide acetate is activated by glucagon receptors resulting in significant weight loss and increased energy expenditure.
    5. Retatrutide acetate can be used in studies of obesity.

    Shop Peptide Factory, High PurityCortagen 20mg pancragen  chonluten ovagen cagrilintide mazdutide  survodutide-Detailed Image 3
    Shop Peptide Factory, High PurityCortagen 20mg pancragen  chonluten ovagen cagrilintide mazdutide  survodutide-Detailed Image 4
    Shop Peptide Factory, High PurityCortagen 20mg pancragen  chonluten ovagen cagrilintide mazdutide  survodutide-Detailed Image 5
    Shop Peptide Factory, High PurityCortagen 20mg pancragen  chonluten ovagen cagrilintide mazdutide  survodutide-Detailed Image 6
    Shop Peptide Factory, High PurityCortagen 20mg pancragen  chonluten ovagen cagrilintide mazdutide  survodutide-Detailed Image 7
    Shop Peptide Factory, High PurityCortagen 20mg pancragen  chonluten ovagen cagrilintide mazdutide  survodutide-Detailed Image 8
    Why choose us:
    1. All peptides and raws purity >=99% purity
    2. 100% Safe delivery
    3.Reasonable & competitive price, fast lead time.
    4.Faster  delivery:Sample order in stock and one week for bulk production.
    5. Any inquiries will be replied within 24 hours.
    Shop Peptide Factory, High PurityCortagen 20mg pancragen  chonluten ovagen cagrilintide mazdutide  survodutide-Detailed Image 9
    Shop Peptide Factory, High PurityCortagen 20mg pancragen  chonluten ovagen cagrilintide mazdutide  survodutide-Detailed Image 10
    Shop Peptide Factory, High PurityCortagen 20mg pancragen  chonluten ovagen cagrilintide mazdutide  survodutide-Detailed Image 11
    Shop Peptide Factory, High PurityCortagen 20mg pancragen  chonluten ovagen cagrilintide mazdutide  survodutide-Detailed Image 12
    Shop Peptide Factory, High PurityCortagen 20mg pancragen  chonluten ovagen cagrilintide mazdutide  survodutide-Detailed Image 13
    Shop Peptide Factory, High PurityCortagen 20mg pancragen  chonluten ovagen cagrilintide mazdutide  survodutide-Detailed Image 14

    Pls inp

    • The importance of peptides:
    • Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.
    Shop Peptide Factory, High PurityCortagen 20mg pancragen  chonluten ovagen cagrilintide mazdutide  survodutide-Detailed Image 15
    Shop Peptide Factory, High PurityCortagen 20mg pancragen  chonluten ovagen cagrilintide mazdutide  survodutide-Detailed Image 16

    Pls inp

    • The importance of peptides:
    • Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.Shop Peptide Factory, High PurityCortagen 20mg pancragen  chonluten ovagen cagrilintide mazdutide  survodutide-Detailed Image 17
    FAQ

    Q1: About the after-sale service
    A: After purchasing the products from our Lab, we have A professional technical team and after-sales team to serve you and solve all your problems in the future

    Q2: Can I get some samples?
    A: Yes, we can provide samples, but the customer will pay the freight.

    Q3: How do I start paying?
    Payment can be made by Bitcoin,wire transfer or paypal

    Q4: How to confirm product quality before placing an order?
    A: We got good feedback from customers and Tested by third-party institutions. You also can get free samples of some products. You just have to pay the shipping fee for the sample .
    You can send us your product specifications and requirements and we can customize for you.

    Q5: What is your MOQ?
    A: The minimum quantity we can order is 1 box.
    But usually we can accept a smaller quantity, say 100g, at the cost of 100% sample charge.

    Q6: Time for delivery?
    A: Leading time within 3 business days,Shipping time about 8-10 business days.

    Certificates
    • Fast Delivery LL-37 3710 High Qulity CN Manufacturer Supply Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

    Location:

    Room 11B, Building 0056, No. 81-1 Nonglinxia Road, Yuexiu District, Guangzhou City, Guangdong Province

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.