Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 375 On-sale now Budget friendly Manufacturer Supply
LL37 375 On-sale now Budget friendly Manufacturer Supply buy - large image1
LL37 375 On-sale now Budget friendly Manufacturer Supply buy - image1
LL37 375 On-sale now Budget friendly Manufacturer Supply buy - image2
LL37 375 On-sale now Budget friendly Manufacturer Supply buy - image3
LL37 375 On-sale now Budget friendly Manufacturer Supply buy - image4
LL37 375 On-sale now Budget friendly Manufacturer Supply buy - image5
LL37 375 On-sale now Budget friendly Manufacturer Supply buy - image6

LL37 375 On-sale now Budget friendly Manufacturer Supply

3 Inquiries

Unit Price:

$20-25/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GUANGZHOU

Brand:

SH

Packaging:

20mg/vial

Price valid (until):

2027-12-30

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Acetic acid water,Tirzepatide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Sales manager :Beibei

    Whatsapp:+852 4742 7839

    Email:zhenbo202603@163.com

    Shop LL37 375 On-sale now Budget friendly Manufacturer Supply-Detailed Image 1
    Shop LL37 375 On-sale now Budget friendly Manufacturer Supply-Detailed Image 2 Shop LL37 375 On-sale now Budget friendly Manufacturer Supply-Detailed Image 3

    Company Introduction

    Qingdao Fengxi Biotechnology Co., Ltd. specializes in the production of diverse peptide products and chemical raw materials.
    Backed by a professional R&D team and a dependable, high-efficiency logistics workforce, we guarantee the safe and timely delivery of premium products. Our client base spans across multiple regions worldwide, including Europe, Japan, South Korea, India and other areas. The majority of our mainstream products are kept in stock for immediate dispatch. Kindly inform us of your required quantities, and we will quote you our most favorable prices. Feel free to reach out if you need further details.
    Our full lineup of peptides finds extensive applications in life science research, pharmaceutical development, cosmetics, anti-aging treatments and functional health products. We deliver peptides featuring stable quality and competitive pricing, which have earned consistent positive reviews from purchasers across the globe. We welcome trustworthy buyers worldwide to get in touch for peptide cooperation.

    1. Outstanding Product Quality

    Quality is the core pillar of our operations. All peptides are manufactured via solid-phase peptide synthesis (SPPS), followed by HPLC purification and mass spectrometry (MS) verification.
    A full Certificate of Analysis (COA) is provided for every batch, covering core test indicators:
    • HPLC-tested purity
    • Molecular weight identified by MS
    • Moisture content
    • Residual solvent content
    • Microbial limits (where applicable)
    For customers with stringent compliance requirements, we can also provide third-party inspection reports, LAL endotoxin test data and stability assessment documents upon request.

    2. Custom Solutions & R&D Services

    Equipped with a seasoned R&D team, we provide flexible custom synthesis services. We are capable of developing brand-new peptide sequences, producing cosmetic-grade peptides, and creating modified molecules such as PEGylated and acetylated peptides, ensuring high-standard outputs and on-time delivery.
    Our service scope includes:
    • Custom peptide synthesis (from milligram to kilogram scale)
    • Peptide modification and labeling
    • Small molecule compound synthesis
    • Project-oriented research and production scale-up
    We maintain close communication with clients throughout the whole development process, to secure technical viability, swift lead times and reasonable cost control.

    3. Diverse Product Range

    We offer a complete and continuously updated product catalog:
    • Peptides: GLP-1 analogs (Semaglutide, Tirzepatide, Retatrutide, etc.), cosmetic peptides (Acetyl Hexapeptide-8, Matrixyl, etc.), anti-aging peptides and research-use peptides.
    • Small molecules: Nootropics, NAD+ supplements (NMN, NR, NADH, etc.) and chemical intermediates.
    • Biochemical products: Amino acid derivatives, enzyme cofactors and custom laboratory reagents.
    We continuously roll out new items to keep pace with market demands. For clients with long-term or seasonal procurement needs, we also accept bulk stock reservations.


    1.:We offer various types of peptides,about the peptides,we can provide the good quality,the good price.
    Customers who have ordered our products(peptides)have had very good feedback.
    World wide relaible buyers can contact us about the peptides.

    2:Company advantages

    Are you from these countries?United States, Canada, Spain, Portugal, Australia, Brazil, France, Netherlands, United Kingdom, Bulgaria, Norway, and more.
    Good News! We guarantee smooth customs clearance in key destinations, including Germany and Finland, with no issues at all. Your packages will be securely delivered within 5-15 days.

    Why Choose Us:
    Fast Delivery: We ship your order quickly using DHL, FedEx, and other options. Most orders arrive in 5-15 days.
    Customs Clearance: No customs problems! We make sure your order is delivered smoothly.
    Easy Payment: Pay with Bitcoin,USDT, or bank transfer.
    Good Quality: Our products are great, and we support small test orders.

    3:FAQ

    Q1:Are you a supplier or a manufacturer?
    A:We are both a supplier and a manufacturer.

    Q2:How will you deliver the goods?
    A:We have strong cooperation with Special express line, FEDEX, China Air Post. For container products, we can do sea shipping. You also can choose your own shipping forwarder.

    Q3:Which kind of payment terms do you accept?
    A:, Bitcoin.USDT.Alipay

    Q4:How is the after-sales service?
    A:We will provide high-quality products and ensure 100% safe deliver.

    Q5:how can we guarantee quality?
    A:We will send you a COA (Certificate of Analysis) to you first for you to confirm the quality.

    Q6: How to confirm the Product Quality before placing orders?
    A:You can get free samples for some products, you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.

    Q7:Is there any discount?
    A:Yes, for larger quantity, we always support with better price.

    LL37 5mg*10vials
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Acetic acid water,Tirzepatide

    Location:

    Room 2701-A046,Building 2,No.76 Lianyungang Road,Shibei District,Qingdao City,Shandong Province,P.R.China

    Year of Establishment:

    2023

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.