Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > LL37 | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder
LL37  | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder buy - large image1
LL37  | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder buy - image1
LL37  | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder buy - image2
LL37  | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder buy - image3
LL37  | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder buy - image4
LL37  | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder buy - image5
LL37  | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder buy - image6

LL37 | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder

TDS 1 Inquiries

Unit Price:

$2/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.8%

Port:

Chinese mainland

Brand:

any

Packaging:

Vial/Bottle/Bag/Carton

Price valid (until):

2026-08-27

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Semag lutide,Tirzepatide,Retatrutide,raw material,GHK-CU,TB500(Thymosin B4 AceTate)

  • Product Description

  • Seller Information

  • History Price

  • Inquiry History

  • Description


      Product Detail  


    What is it?     T hy malin is a natural polypeptide complex extracted from  calf thymus glands , containing various biologically active small protein molecules (peptides). It is not a single compound, but a natural combination of multiple thymic hormones that mimic the function of a young, healthy thymus.

    Thy ma lin is a natural polypeptide complex extracted from calf thymus glands, essentially a set of synergistic bioactive signaling molecules. Its core function is to  reboot and optimize the immune system's "command center" —the thymus, an organ that atrophies with age, leading to declining bodily defenses. By delivering key "instructions" necessary for normal thymic function, Thymalin promotes the maturation and training of new immune cells and coordinates communication between different immune components. This helps the body respond more intelligently to infections, aging, and stress. It not only enhances weakened immune function but also balances excessive immune responses. In the field of anti-aging, it demonstrates unique potential—by revitalizing thymic function, it may delay immune senescence, improve tissue repair capacity, and even enhance overall vitality. Though it has decades of clinical use in countries like Russia, it remains a regenerative medicine tool requiring professional guidance rather than a mainstream supplement.

    Uses    Immune Function Restoration : For immune system decline due to aging, illness, stress, or treatments like chemotherapy/radiation

    Anti-aging Intervention : As part of comprehensive anti-aging protocols to reverse age-related immune decline

    Infection Adjunct Therapy : Helping the body fight stubborn, recurrent infections

    Post-operative/Trauma Recovery : Accelerating recovery after surgery, burns, or severe trauma

    Elderly Health Maintenance : Helping older adults maintain better overall health and infection resistance

    Functions      

    1."Reboot" the Immune System : Like "recharging and restarting" an aging immune system

    2.Increase "Immune Soldiers" : Promote the body to produce more and more effective immune cells

    3.Improve Recognition Ability : Help the immune system better distinguish between "self" and "invaders"

    4.Coordinate Immune Responses : Ensure immune responses are strong enough but not excessive

    5.Promote Whole-body Repair : Benefits not only the immune system but also repairs other tissues  

    Mechanism of Action  

      1.The Thymus's Role :

    The thymus is the "military academy" that trains immune cells (T-cells)

    A young thymus efficiently trains large numbers of elite "immune soldiers"

    But as we age (after 20s), this "academy" gradually shrinks and becomes less efficient

    2.How Thymalin   Works :

    Supplies "Training Materials" : Thymalin provides the various "training materials" the thymus needs to function properly

    Restores Academy Function : Helps the aging "military academy" regain some training capacity

    Produces New Recruits : Promotes the generation of new, combat-effective immune cells

    Enhances Veteran Ability : Also improves the function of existing immune cells

    Improves Communication : Optimizes "communication and coordination" between different parts of the immune system

    3.Simple Analogy :

    Like  replacing the battery + system optimization ​ for an aging phone, not just charging the old battery

    Not only increases "soldier numbers" but improves "soldier quality" and "command system efficiency"

    1. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.



    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.



    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    1. Expertise in Peptide Synthesis

    Extensive Experience: 10 Years of expertise in synthetic peptide development.

    Skilled Team: Experts in solid-phase and liquid-phase synthesis.



    2. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.



    3. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach:  pharmaceutical firms & industrial clients worldwide.
    Items Specifications

    5mg




    Shop LL37  | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder-Detailed Image 1 Shop LL37  | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder-Detailed Image 2 Shop LL37  | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder-Detailed Image 3 Shop LL37  | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder-Detailed Image 4 Shop LL37  | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder-Detailed Image 5 Shop LL37  | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder-Detailed Image 6
    Shop LL37  | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder-Detailed Image 7
    Shop LL37  | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder-Detailed Image 8
    Shop LL37  | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder-Detailed Image 9
    Shop LL37  | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder-Detailed Image 10

    Certificates
    • LL37  | Cosmetic Peptides | 99% Purity | 5mg Vials | Lyophilized Powder Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Semag lutide,Tirzepatide,Retatrutide,raw material,GHK-CU,TB500(Thymosin B4 AceTate)

    Location:

    Room 1002-C3973, No. 80, Yongtai Modaonan Street, Yongping Subdistrict, Baiyun District, Guangzhou City

    Payment Terms:

    TT against copy of documents,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    45

    Year of Establishment:

    2026

    Anymang is a US-based trading company dedicated to the global supply and formulation of high-quality cosmetic raw materials, with a core focus on peptide ingredients. Committed to bridging premium suppliers and beauty manufacturers worldwide, we deliver pure, stable, and efficacious peptides—including anti-aging, brightening, and firming peptides—alongside a full spectrum of cosmetic actives and custom formulation solutions. With rigorous quality control and compliance with US safety standards, we ensure consistent batch quality and reliable delivery. Our experienced team provides professional technical support and tailored services to help clients develop competitive skincare and personal care products. Trusted by partners across the globe, Anymang stands as your dependable partner for innovative, high-performance cosmetic raw materials and peptide formulations.

  • Weekly Price

    The chart shows the price trend of the product in the past 12 months.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.