Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Anti-seborrheic > LL-37 for Sale > PI10 P20 B12 MZ SUR10 CS5 CS10 GLOW70 HHB SHB AK100 CP10 CBL60 G25 G65 G610 wu AP5 G5K G10K
PI10 P20 B12 MZ SUR10 CS5 CS10 GLOW70 HHB SHB AK100 CP10 CBL60 G25 G65 G610 wu AP5 G5K G10K buy - large image1
PI10 P20 B12 MZ SUR10 CS5 CS10 GLOW70 HHB SHB AK100 CP10 CBL60 G25 G65 G610 wu AP5 G5K G10K buy - image1
PI10 P20 B12 MZ SUR10 CS5 CS10 GLOW70 HHB SHB AK100 CP10 CBL60 G25 G65 G610 wu AP5 G5K G10K buy - image2
PI10 P20 B12 MZ SUR10 CS5 CS10 GLOW70 HHB SHB AK100 CP10 CBL60 G25 G65 G610 wu AP5 G5K G10K buy - image3
PI10 P20 B12 MZ SUR10 CS5 CS10 GLOW70 HHB SHB AK100 CP10 CBL60 G25 G65 G610 wu AP5 G5K G10K buy - image4
PI10 P20 B12 MZ SUR10 CS5 CS10 GLOW70 HHB SHB AK100 CP10 CBL60 G25 G65 G610 wu AP5 G5K G10K buy - image5
PI10 P20 B12 MZ SUR10 CS5 CS10 GLOW70 HHB SHB AK100 CP10 CBL60 G25 G65 G610 wu AP5 G5K G10K buy - image6

PI10 P20 B12 MZ SUR10 CS5 CS10 GLOW70 HHB SHB AK100 CP10 CBL60 G25 G65 G610 wu AP5 G5K G10K

TDS 1 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

SC

Packaging:

10 mg / 15mg/ 20 mg / 30 mg / 10 tubes per box

Price valid (until):

2027-06-23

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Sales manager: Freya

    WhatsApp:+85270353922


    Why Choose Us
    •High quality products: We have rich experience in production and processing, strict quality inspection.

    •Reasonable prices: Factory direct, reasonable price and negotiable.

    •Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications

    •Quick response: We will reply to your message within 24 hours.

    •Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.

    Shop PI10 P20 B12 MZ SUR10 CS5 CS10 GLOW70 HHB SHB AK100 CP10 CBL60 G25 G65 G610 wu AP5 G5K G10K-Detailed Image 1

    FAQ

    1. About Our Company
    Q: Are you a direct manufacturer or a distributor? A: We operate as both—a certified peptide manufacturer and global supplier, ensuring quality control from production to delivery.

    2. Shipping & Delivery
    Q: What is the estimated delivery time? A: Orders are typically delivered within 7-15 working days via express couriers (DHL/UPS/FedEx) or air freight. Sea shipping is available for bulk orders.

    3. Logistics Partners
    Q: Which carriers do you work with? A: We partner with major logistics providers (EMS, TNT, China Air Post) and accommodate custom freight requests.

    4. Order Quantity

    Q: Is there a minimum order requirement? A: Standard products start at 1 box; customized peptides require 10-50 boxes (MOQ varies by formulation).

    5. Bulk Pricing
    Q: Do you offer discounts for large orders? A: Yes—contact us for tiered pricing based on volume.

    6. Custom Branding

    Q: Can I add my logo to the packaging? A: Absolutely. Submit your logo design (AI/vector file), and we’ll provide a mockup for approval.

    7. Global Reach

    Q: Where do you export to? A: We serve clients worldwide, complying with international shipping regulations.

    Shop PI10 P20 B12 MZ SUR10 CS5 CS10 GLOW70 HHB SHB AK100 CP10 CBL60 G25 G65 G610 wu AP5 G5K G10K-Detailed Image 2

    Introduction

    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

    The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

    Shop PI10 P20 B12 MZ SUR10 CS5 CS10 GLOW70 HHB SHB AK100 CP10 CBL60 G25 G65 G610 wu AP5 G5K G10K-Detailed Image 3

    Our Advantages

    ‌1. Quality assurance:

    factory-produced, good quality, batch purity ≥ 99%, stability data report, free COA.++

    ‌2. Product advantages:

    According to the different actual conditions of customers, we can meet customers' customized needs, including but not limited to product ingredients, label customization, and lid color. Flexible to meet diversified needs.

    ‌3. Service added value:

    Super-speed delivery‌: Regular sequence delivery within 7-14 working days, urgent orders can be expedited to 5 working days (without any expedited fee), ‌Global worry-free logistics‌: DDP customs clearance service covers more than 100 countries including Europe and the United States, Technical empowerment‌: Free reconstitution advice, storage solutions and structural optimization consultation. Make R&D procurement more efficient and worry-free

    ‌4. Cooperation Guarantee:

    Price competitiveness‌: Own synthesis platform + large-scale production, the price of the same purity is 40-60% lower than that of European and American suppliers. Flexible cooperation model‌: Support small batch trial orders and signing of confidentiality agreements for patented peptides. Quality commitment‌: Re-shipment in case of problems, controllable risks and cost optimization.

    Shop PI10 P20 B12 MZ SUR10 CS5 CS10 GLOW70 HHB SHB AK100 CP10 CBL60 G25 G65 G610 wu AP5 G5K G10K-Detailed Image 4

    Key Specifications/ Special Features:
    As a leading peptide manufacturing powerhouse, we specialize in producing high - quality peptides with unmatched precision and consistency. Our state - of - the - art facilities are equipped with advanced synthesis and purification technologies, ensuring that each peptide product meets the highest industry standards. Whether it's pharmaceutical - grade peptides for research and development, functional peptides for nutraceuticals, or cosmeceutical peptides for skincare applications, we offer a comprehensive range of solutions.

    We also offer a wide variety of peptide types, such as oligopeptides, polypeptides, and modified peptides. Oligopeptides, with their small molecular size, are highly absorbable and ideal for applications where rapid penetration and bioavailability are crucial, like in dietary supplements aimed at boosting immune function or promoting muscle recovery. Polypeptides, on the other hand, are well - suited for complex biological functions and are frequently used in the development of therapeutic drugs. Modified peptides, which can be customized with specific chemical groups, open up new possibilities for targeted drug delivery and enhanced stability.

    Our production process adheres to strict quality control protocols, from raw material sourcing to final product packaging. With a team of experienced scientists and technicians, we can customize peptide sequences according to specific client requirements, providing tailor - made solutions for diverse industries. Our commitment to innovation, reliability, and customer satisfaction makes us the preferred partner for all your peptide manufacturing needs.

    Shop TA5 TA10 CND5 CND10 CD5 2S10 2S50 MT1 ML10 OT2 RA10 P41 BBG70 KLOW80-Detailed Image 5


    Packaging
    Packing:We will pack our products tightly to ensure that they are not damaged in trasit.


    Delivery:We have good cooperation with many prodessional forwarders.We can send the products to you once you confrim the order.

    Shop VIP5 VIP10 IG01 IG1 IP5 IP10 MS10 MS40 322  ET10 ET50 DS5 DS15-Detailed Image 6

    Transportation

    Shop LC216 LC216 LC526 LC600 CBL60 5AD SMO5 SMO10 KS5 KS10 BB10 BB20 KPV5 KPV10 AK100-Detailed Image 8

    Main Export Markets


    Main Export Markets Asia,Australasia,Central/South America,Eastern Europe,Mid East/Africa,North America,Western Europe

    Shop LC216 LC216 LC526 LC600 CBL60 5AD SMO5 SMO10 KS5 KS10 BB10 BB20 KPV5 KPV10 AK100-Detailed Image 9

    Shop LC216  LC526 LC600 CBL60 5AD SMO5 SMO10 KS5 KS10 BB10 BB20 KPV5 KPV10 AK100 Peptide drugs-Detailed Image 10 Shop LC216 LC216 LC526 LC600 CBL60 5AD SMO5 SMO10 KS5 KS10 BB10 BB20 KPV5 KPV10 AK100-Detailed Image 11

    Payment Details
    Payment Method PayPal

    Shop Pinealon PI5 PI10 P20 B12 MZ SUR10 CS5 CS10 GLOW70 HHB SHB AK100 CP10 Of the best quality-Detailed Image 12

    Certificates
    • PI10 P20 B12 MZ SUR10 CS5 CS10 GLOW70 HHB SHB AK100 CP10 CBL60 G25 G65 G610 wu AP5 G5K G10K Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Anti-seborrheic

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    20 years of production experience in peptide products

    Safe and unobstructed shipping channels|High quality guaranteed|

    Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.


  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.