Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Copper Peptide LL37 with Best Price and High Quality.
Copper Peptide LL37 with Best Price and High Quality. buy - large image1
Copper Peptide LL37 with Best Price and High Quality. buy - image1
Copper Peptide LL37 with Best Price and High Quality. buy - image2
Copper Peptide LL37 with Best Price and High Quality. buy - image3
Copper Peptide LL37 with Best Price and High Quality. buy - image4
Copper Peptide LL37 with Best Price and High Quality. buy - image5
Copper Peptide LL37 with Best Price and High Quality. buy - image6

Copper Peptide LL37 with Best Price and High Quality.

GMP ISO TDS 3 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Cosmetics Grade

Content:

99%

Port:

Yangshan Port

Brand:

SHUNZHICHENG

Packaging:

5mg 10mg 15mg/vial,10vials/box

Price valid (until):

2026-09-11

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Semaglutide, tirzepatide, retatrutide, pharmaceutical peptides, cosmetic peptides, custom peptides,

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Name:Luna

     WhatsApp: +852 4732 5239

    Email:sales03@tjszc.com

    Description
    cas154947-66-7 LL37   Details
    cas 154947-66-7
    Name LL37
    Synonyms SUNTHEANINE
    THEANINE,L
    N5-ethyl-L-glutamine
    theanine
    L-TheaMine
    MF C205H340N60O53
    Purity 99%
    Application Ll-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.


    cas154947-66-7 LL37  benefits


    Ll-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.


    Basic Info


    Characteristics


    Shop Copper Peptide LL37 with Best Price and High Quality.-Detailed Image 1

    Shop Copper Peptide LL37 with Best Price and High Quality.-Detailed Image 4

    Shop Copper Peptide LL37 with Best Price and High Quality.-Detailed Image 5 Shop Copper Peptide LL37 with Best Price and High Quality.-Detailed Image 6


     

      Advantage  

     


    1. Ultra-High Purity

    Each batch is synthesized and purified to >99% purity, ensuring reliable and reproducible results in sensitive experiments.


    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.


    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    Who We Serve


    -We proudly work with clients across North America, Europe, Asia, and Latin America, including:

    -Biotech and pharma firms

    -Research institutions & universities

    -Peptide formulation startups

    -CDMOs and CRO partners

    Shop Copper Peptide LL37 with Best Price and High Quality.-Detailed Image 7

    We are a chemical manufacturer integrating production, processing and export, mainly dealing in pharmaceutical intermediates and various industrial chemicals. Since its establishment, the company adheres to the spirit of "integrity management, strict quality control, customer first", and has won praise from customers at home and abroad. We have also established an excellent professional sales team with rich international marketing experience, able to efficiently provide a range of products and professional services.


    With synthetic biology platform technology as the core, it conducts innovative research and development, mainly engaged in the research and development of recombinantly expressed pharmaceutical peptides and proteins. Its products include innovative drugs, APIs, pharmaceutical and green synthetic industrial enzymes, functional peptides and protein products, etc.


    At present, our company has realized the industrialization of a variety of biosynthetic peptide products and has obtained cooperation orders from many well-known domestic and foreign pharmaceutical companies.

    Shop Copper Peptide LL37 with Best Price and High Quality.-Detailed Image 8 Shop Copper Peptide LL37 with Best Price and High Quality.-Detailed Image 9


     

      FQA

     


    1. How to make an order?

    Send me message and let me know what you need with quantity , then i will calculate to you.


    2. What's the lead time and shipping ways?

    We will delivery to the package by USPS, FEDEX, DHL paket and UPS express to you after receive your payment, it would take around 5-15 days to your address.


    3. How do i keep the peptides when I receive it ?

    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    Items Specifications






    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    Copper Peptide LL37 with Best Price and High Quality. is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • Copper Peptide LL37 with Best Price and High Quality. Certificates 3 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Semaglutide, tirzepatide, retatrutide, pharmaceutical peptides, cosmetic peptides, custom peptides,

    Location:

    Room 314A, Block A, Tianjin Youth Entrepreneurship Park, No. 85 Qingnian Road, Hongqiao District, Tianjin

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    20

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    101-200

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.