Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > High Purity LL37 99% 10mg Research Peptide Lyophilized Powder CAS 154947-66-7
High Purity LL37 99% 10mg Research Peptide Lyophilized Powder CAS 154947-66-7 buy - large image1
High Purity LL37 99% 10mg Research Peptide Lyophilized Powder CAS 154947-66-7 buy - image1
High Purity LL37 99% 10mg Research Peptide Lyophilized Powder CAS 154947-66-7 buy - image2
High Purity LL37 99% 10mg Research Peptide Lyophilized Powder CAS 154947-66-7 buy - image3
High Purity LL37 99% 10mg Research Peptide Lyophilized Powder CAS 154947-66-7 buy - image4
High Purity LL37 99% 10mg Research Peptide Lyophilized Powder CAS 154947-66-7 buy - image5
High Purity LL37 99% 10mg Research Peptide Lyophilized Powder CAS 154947-66-7 buy - image6

High Purity LL37 99% 10mg Research Peptide Lyophilized Powder CAS 154947-66-7

TDS 3 Inquiries

Unit Price:

$9.1/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Research Grade

Content:

99%

Port:

ShenZhen

Brand:

XH

Packaging:

10 vials/kit, 10mg/vial or customized specification

Price valid (until):

2026-09-30

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,Semaglutide,GHK-CU,NAD+,MOTS-C

  • Product Description

  • Seller Information

  • History Price

  • Inquiry History

  • Description


      Product Detail  


    LL37, is a research peptide and pharmaceutical intermediate. It is commonly supplied as white lyophilized powder for laboratory research, analytical reference and further manufacturing use.

    We provide LL37 in different specifications. Each kit contains 10 vials. Custom specifications, private label and packaging can be arranged according to customer requirements.



      Product Features  


    • 1.High purity lyophilized peptide powder
    • 2.Multiple specifications available
    • 3.COA, HPLC and LC-MS reports available for batch quality reference
    • 4.Custom label and customized packaging available
    • 5.Stable supply and fast order processing
    • 6.Suitable for research peptide and pharmaceutical intermediate use
    • 7.Support small trial orders and customized requirements


      Product Information  


    Product Name:LL37
    CAS No.: 154947-66-7
    Appearance: White lyophilized powder
    Purity: ≥99% or customized according to batch COA
    Specification: 5mg/vial, 10 vials/kit
    Grade: Research Grade / Reagent Grade
    Test Method: HPLC, LC-MS
    Documents: COA, HPLC, LC-MS available
    Packaging: Sealed glass vial and carton package
    MOQ: 1 unit
    Unit Meaning: 1 unit = 1 kit = 10 vials
    Storage: Store in a cool, dry place, protected from light
    Application: Laboratory research / pharmaceutical intermediate
    Custom Service: Private label, custom packaging and custom specification available


      Quality Control  


    We pay close attention to batch quality control. Each batch can be tested by HPLC and LC-MS before shipment. COA, HPLC and LC-MS reports can be provided for customer reference.

    Our quality control process includes appearance inspection, purity testing, identity confirmation and packaging inspection. Products are packed carefully to help maintain product stability during storage and international transportation.


      Packaging 


    Standard package: 10 vials/kit
    Vial package: sealed glass vial
    Outer package: carton box
    Custom label: available
    Custom package: available according to customer requirements

    The product will be packed carefully before shipment. Neutral packaging and customized label service can be provided.


      Shipping  


    We can arrange international shipment according to customer requirements. Common shipping methods include express delivery and special line shipping. Tracking information will be provided after shipment.

    Lead time: usually 48-72 hours after order confirmation
    Shipping time: usually 7-15 days, depending on destination country and shipping method


      Company Profile  


    Yiwu Xinhong Trading Co., Ltd. is a peptide supplier focusing on research peptides and pharmaceutical intermediates. We provide a wide range of peptide products with different specifications and packaging options.

    We support batch quality documents such as COA, HPLC and LC-MS reports. Custom labeling, packaging and specification service can also be arranged according to customer requirements.

    Our goal is to provide stable product quality, reliable supply and professional service for global customers.


      FAQ  


    Q1: What is the MOQ?
    A: The MOQ is 1 unit. 1 unit means 1 kit, and each kit contains 10 vials.

    Q2: What documents can you provide?
    A: COA, HPLC and LC-MS reports can be provided for batch quality reference.

    Q3: Can you provide custom label or packaging?
    A: Yes, custom label and customized packaging are available according to customer requirements.

    Q4: How long is the lead time?
    A: Usually 48-72 hours after order confirmation.

    Q5: What shipping methods are available?
    A: Express delivery and special line shipping are available. The shipping method can be arranged according to the destination country.

    Q6: Is this product for direct human use?
    A: No. This product is supplied for laboratory research and further manufacturing use only. Not for human direct human use.

    Items Specifications
    Product Name LL37
    CAS No. 154947-66-7
    Synonyms FTPP, Adipotide Peptide, Prohibitin-targeting Peptide
    Product Type Research Peptide / Pharmaceutical Intermediate
    Appearance White lyophilized powder
    Purity 99%
    Specification 2mg/vial, 5mg/vial, 10 vials/kit
    Available Strength 5mg/vial or customized
    Grade Research Grade / Reagent Grade
    Test Method HPLC, LC-MS
    Documents COA, HPLC, LC-MS available
    Identification Conforms to reference standard
    Solubility Subject to batch COA
    Moisture Subject to batch COA
    Related Substances Subject to batch COA
    Residual Solvents Subject to batch COA
    Heavy Metals Subject to batch COA
    Endotoxin Subject to batch COA if required
    Batch Testing Available before shipment
    Standard Package 10 vials/kit
    Packaging Sealed glass vial and carton package
    MOQ 1 unit
    Unit Meaning 1 unit = 1 kit = 10 vials
    Custom Service Private label, custom packaging and custom specification available
    Lead Time Usually 48-72 hours after order confirmation
    Shipping Method Express delivery or special line shipping
    Storage Store in a cool, dry place, protected from light
    Shelf Life Subject to storage condition and batch document
    Application Laboratory research / pharmaceutical intermediate



    Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 1 Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 2 Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 3 Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 4 Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 5 Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 6 Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 7Research Peptide / Pharmaceutical Intermediate




    Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 8
    Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 9
    Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 10
    Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 11
    Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 12
    Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 13
    Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 14
    Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 15
    Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 16
    Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 17
    Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 18
    Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 19
    Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 20
    Shop High Purity Melanotan 2 Acetate MT-2 10mg Research Peptide Lyophilized Powder CAS 121062-08-6-Detailed Image 21
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    High Purity LL37 99% 10mg Research Peptide Lyophilized Powder CAS 154947-66-7 is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,Semaglutide,GHK-CU,NAD+,MOTS-C

    Location:

    Block 1, No. 205, Tongbao Road, Jiangdong Street, Yiwu City, Jinhua City, Zhejiang Province (within Zhejiang Juzhiyun Holding Co., Ltd., on the 4th floor of 2 buildings)

    Payment Terms:

    TT against copy of documents,O/A,100% TT in advance

    Total Employees:

    101-200

    Year of Establishment:

    2026

    Company Profile

    Yiwu Xinhong Trading Co., Ltd. is a professional trading company engaged in the international supply and distribution of peptides, chemical raw materials.
    Leveraging a reliable network of qualified manufacturers and strategic partners, we provide customers with high-quality products, competitive pricing, and efficient supply chain solutions. Our products are widely used in pharmaceutical research, biotechnology, chemical manufacturing, laboratory research, and various industrial applications.

    With extensive experience in international trade, we are committed to helping customers source quality chemical products from China through professional procurement services, strict supplier selection, and reliable logistics support. We focus on building long-term partnerships by delivering consistent quality, responsive communication, and dependable service.

    Main Products
    Peptides
    Chemical Raw Materials
    Organic Chemicals
    Inorganic Chemicals
    Fine Chemicals
    Our Advantages
    Professional international trading services
    Reliable supplier network
    Competitive pricing and flexible sourcing
    Strict quality control and supplier management
    Fast response and efficient communication
    Global export and logistics support
    Business Scope

    Global sourcing, international trade, import and export of chemical products, customized procurement solutions, and supply chain services.

    Markets

    Europe, North America, South America, Southeast Asia, the Middle East, and other international markets.

    Yiwu Xinhong Trading Co., Ltd. is committed to providing professional chemical sourcing solutions and creating long-term value for customers worldwide. We look forward to establishing mutually beneficial partnerships with clients across the globe.

    Business Type: Trading Company
    Company Name: Yiwu Xinhong Trading Co., Ltd.
    Main Business: Peptides, Chemical Raw Materials
    Market: Global

  • Weekly Price

    The chart shows the price trend of the product in the past 12 months.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.