Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 RT Retatrutide efficient 99%
LL37 RT Retatrutide efficient 99% buy - large image1
LL37 RT Retatrutide efficient 99% buy - image1
LL37 RT Retatrutide efficient 99% buy - image2
LL37 RT Retatrutide efficient 99% buy - image3
LL37 RT Retatrutide efficient 99% buy - image4
LL37 RT Retatrutide efficient 99% buy - image5
LL37 RT Retatrutide efficient 99% buy - image6

LL37 RT Retatrutide efficient 99%

TDS 3 Inquiries

Unit Price:

$92/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.55%

Port:

shenzhen

Brand:

AoXin

Packaging:

5mg/vial,10vials/box

Sample Available:

Yes

Price valid (until):

2026-09-30

Company Type:
Trader
Location:
China
Payment Terms:
TT against copy of documents
Average Lead Time:
1 days
Qualification:
Main Products:

GLP-1,Retatrutide,Selank,Tirzepatide

  • Product Description

  • Seller Information

  • History Price

  • Inquiry History

  • Description


      Product Detail  


     

    Sales Manager:fad

    WhatsApp:+85253189586

    Email:du@tianjinaoxin.com

    This newly upgraded high-purity active functional material is tailor-developed for global beauty and skincare formulation systems. As a high-end cosmetic-specific raw material, it is perfectly applicable to full scenarios including high-end skincare product research and development, commercial formula production and cutting-edge cosmetic scientific research.
      It owns four core advantages: ultra-high purity, excellent solubility in all systems, long-term physicochemical stability and broad formulation compatibility. With uniform and fine texture as well as stable physicochemical properties, this material can be well compatible with various complex skincare formulations such as aqueous phases, oil phases and emulsion systems. It will not lead to formulation defects including stratification,precipitation, system flocculation and antagonistic inactivation of active ingredients after addition, greatly lowering formula debugging difficulty and enhancing the stability of finished cosmetic products.
      Unlike common industrial-grade equivalent materials available on the market, our product implements full-chain production and quality control in line with strict international cosmetic ingredient quality standards.
      Acomprehensive traceable quality inspection system is established covering the whole process from raw material incoming acceptance, standardized production to finished product delivery from warehouse.



    Items Specifications
    CAS NO.  114466-38-5
    Product name LL37
    Purity 99.55%
    Packaging 5mg/vial ,10vials/box
    Shelf life one to three years
    Payment term Alipay, Bitcoin, USDT,USDC




    Why did you choose us

      We are a professional peptide supplier with four major advantages: high-purity products, efficient and safe global logistics, flexible and convenient payment methods, and a dedicated team - all of which are designed to provide better services for you.


    Product Usage

    Peptide-based products have diverse functional advantages in various application scenarios:
    In the field of health management, peptides support metabolic regulation (helping specific groups control blood sugar and maintain a healthy weight) and immune system regulation, enhancing the body's defense response.
    In the field of skincare, peptides can promote skin barrier repair, stimulate collagen synthesis to reduce fine lines, and improve skin moisture and elasticity.
    In sports nutrition, peptide substances help muscle recovery by reducing post-exercise tissue damage and promoting muscle protein synthesis.
    In body management, peptide-based substances help reduce damage, promote metabolism, and contribute to fat burning and slimming.




    Shop RT15 Retatrutide High efficiency and high quality-Detailed Image 1

    Shop LL37 RT Retatrutide efficient 99%-Detailed Image 2  



    Shop RT15 Retatrutide High efficiency and high quality-Detailed Image 2

    Shop LL37 RT Retatrutide efficient 99%-Detailed Image 4



    Shop RT15 Retatrutide High efficiency and high quality-Detailed Image 3

    Shop LL37 RT Retatrutide efficient 99%-Detailed Image 6

    Shop LL37 RT Retatrutide efficient 99%-Detailed Image 7


    Shop LL37 RT Retatrutide efficient 99%-Detailed Image 8

    Shop LL37 RT Retatrutide efficient 99%-Detailed Image 9


    Shop RT15 Retatrutide High efficiency and high quality-Detailed Image 6



    Shop RT15 Retatrutide High efficiency and high quality-Detailed Image 7

    Shop RT15 Retatrutide High efficiency and high quality-Detailed Image 8




    Shop RT15 Retatrutide High efficiency and high quality-Detailed Image 9

    Shop RT15 Retatrutide High efficiency and high quality-Detailed Image 10


    If you have any such requirements, please feel free to contact us! 


    Shop RT15 Retatrutide High efficiency and high quality-Detailed Image 11

    Frequently asked question

    1.Regarding after-sales service

    After purchasing our laboratory's products, we have a professional technical team and an after-sales team to serve you and solve all future problems.

    2.Your inventory situation

    We have sufficient supplies, but due to the large volume of product circulation, the inventory is not very high, and production is constantly being accelerated.

    3.What payment methods are acceptable to you?

    Our payment methods include Alipay, Bitcoin, USDT, USDC and bank transfer.

    4.What is your minimum order quantity?

    Our minimum order quantity is one box.

    5.How to determine product quality?

    Having received positive feedback from our customers, we passed the COA test and presented the COA certificate. We can also offer you a free sample for testing. All you need to pay is the postage cost for the sample.

    6.Specific delivery time and method

    We will dispatch the goods 2 to 5 days after your payment and deliver them within 1 to 2 weeks.We offer dual customs clearance shipping and mailing services. However, you will need to bear the cost of mailing. The shipping fee for each package (approximately 20 boxes) is $70.

    Product Packaging: Each box contains 10 components (the size, labels, and packaging box can be customized according to customer requirements). Transport Conditions: This product is transported as a non-hazardous chemical at normal temperature. During ordinary transportation and customs clearance, the product can be stably stored for several weeks. Storage Conditions: Stored at -20°C, with a shelf life of 1-3 years. Stored at 0-4°C, it should be placed in a dry and cool place, with a shelf life ranging from several weeks to several months. If re-dissolved, please store it refrigerated at 2-8°C (35.6-46.4°F), and use it within 2-4 weeks.





    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates
    • LL37 RT Retatrutide efficient 99% Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

    Research
    Class:

    Triple agonist — GCGR, GIPR, GLP-1R

    Status:

    Investigational (Phase 3)

    Mechanism:

    Simultaneously activates glucagon receptor (GCGR), glucose-dependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R). Engineered from the native GIP backbone with amino acid substitutions to confer GCGR and GLP-1R activity.

    EC50 (Human GCGR):

    5.79 nM

    EC50 (Mouse GIPR):

    0.191 nM

    EC50 (Mouse GLP1R):

    0.794 nM

    EC50 (Mouse GCGR):

    2.32 nM

    EC50 (Human GLP1R):

    0.775 nM

    EC50 (Human GIPR):

    0.0643 nM

    Source:

    Jastreboff AM, et al. N Engl J Med. 2023;389(6):514-526.DOI

    Clinical Development:

    NCT04881760; NCT05882045; NCT06354660

    References
    ChEMBL:

    CHEMBL5095485

    DrugBank:

    DB18993

    KEGG DRUG:

    D12430

    PubChem:

    PubChem

    Disclaimer:

    Retatrutide is an investigational compound not yet approved by FDA or EMA. This listing is for industrial and laboratory research use only. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    GLP-1,Retatrutide,Selank,Tirzepatide

    Location:

    Room 1402, Unit 1, Building 1, Hongxing Mansion, Shanghang Road Sub-district, Hedong District, Tianjin

    Payment Terms:

    TT against copy of documents

    Average lead Time:

    1 days

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Weekly Price

    The chart shows the price trend of the product in the past 12 months.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.