Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > NP810 High quality, extremely useful. close your eyes and buy directly
NP810 High quality, extremely useful. close your eyes and buy directly buy - large image1
NP810 High quality, extremely useful. close your eyes and buy directly buy - image1
NP810 High quality, extremely useful. close your eyes and buy directly buy - image2
NP810 High quality, extremely useful. close your eyes and buy directly buy - image3
NP810 High quality, extremely useful. close your eyes and buy directly buy - image4
NP810 High quality, extremely useful. close your eyes and buy directly buy - image5
NP810 High quality, extremely useful. close your eyes and buy directly buy - image6

NP810 High quality, extremely useful. close your eyes and buy directly

TDS 1 Inquiries

Unit Price:

$1/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.9%

Port:

SHENZHEN

Brand:

customization

Packaging:

10 pieces per box

Price valid (until):

2026-10-31

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

polypeptide,GHK-CU,NAD+,Tirzepatide,GLutathione

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  



    WhatsApp:85265574617 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 1 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 2 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 3 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 4 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 5 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 6 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 7 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 8 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 9 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 10   


    I. Core Function Principle (Improving Expression Lines from the Root)
    1. Competitive interference with SNARE protein complex
    2. Mildly weakening muscle contraction
    Reduced acetylcholine release, decreased contraction force of facial muscles, maintaining natural expression without risk of stiff face.
    3. Reversible effect, safe for external use
    Only acts on the epidermis, does not damage nerve cells, muscle function recovers after discontinuation; only applied externally, no risk of trauma or bruising.
    II. Skin Care Effects (Core Function)
    1. Reducing and Preventing Dynamic Lines
    For lines caused by frequent expressions: frown lines between the eyebrows, forehead wrinkles, crow's feet, fine lines around the eyes, nasolabial folds, and neck lines (technological neck lines caused ).
    - Long-term use: Preventing dynamic lines from solidifying into deep static wrinkles.
    2. Smooth skin texture, reduce skin tension
    Reduce the mechanical stress on the skin caused by long-term pulling of facial muscles, improve roughness and uneven lines, and make the skin surface smoother and more delicate.
    3. Assist in stabilizing collagen and elastic fibers
    Reduce the continuous damage to dermal collagen and elastic proteins caused by repeated muscle stretching, and indirectly delay skin relaxation and aging.
    III. Application Scenarios (Functions within the Product)
    It is commonly used in anti-wrinkle serums, eye creams, anti-aging creams, neck creams, and firming solutions.
    1. Preventing early aging fine lines (applicable to people over 25);
    2. Improving stubborn expression lines caused by frequent smiling or frowning;
    3. Serving as an alternative for those who are afraid of medical treatments and need a home-based anti-wrinkle solution;
    4. Combining with BOSYIN, retinol, and collagen peptides for synergistic anti-aging.

    Items Specifications
    Product Name

    NP810

    Purity 99.9%
    Storage Condition Seal and store in cool dry place


      Company Profile 


    Hong Kong Biopetide Research Limited is a high-tech enterprise specializing in the research, development, production, and sales of peptide products. The company boasts advanced laboratories and a rigorous quality control system, with its products having obtained multiple international certifications, ensuring safety and efficacy.
    Its customers are spread across Europe, the United States, Southeast Asia, the Middle East, and other regions.
    Biotechnology Co., Ltd. is a high-tech enterprise specializing in the research, development, production, and sales of peptide products. With advanced laboratories and a rigorous quality control system, our products have obtained international certification, ensuring safety and efficacy.
    As a global trading company, we provide customized solutions to customers across Europe, the United States, Southeast Asia, the Middle East, and many other regions. Upholding the philosophy of "technology leading health," we are committed to innovation, striving to deliver high-quality health products to consumers worldwide. Our business principles focus on establishing a strong domestic market presence, increasing R&D investment, manufacturing premium products, and leveraging technology to promote environmental protection and sustainable development. At the same time, we actively expand into international markets, serve society with sincerity, and aim to become a modern, eco-friendly, and technologically advanced enterprise that meets global standards. Contact Us

    Our products have been exported to 130 countries and regions. We are committed to building stable, strategic, and long-term partnerships with suppliers and customers both domestically and internationally, working together to create a brighter future.


      Common Problem  


    1. We are the source factory of raw materials, offering high-quality and high-purity raw materials at wholesale prices.
    2. We can provide global delivery services and have an exclusive delivery team to ensure safety and speed.
    3. You can contact us to inquire about any products. Our product range is extensive and we support customization to meet your needs as much as possible.
    4. We support various payment methods and all details can be negotiated.
    5. If you have any questions, please feel free to contact me. I will do my best to answer your questions for you.
    6. Firstly, we guarantee the quality of the products; secondly, we guarantee the efficiency of transportation and the clearance rate; thirdly, we will provide you with the best service in all aspects.

    You get what you pay for. If you have any questions, I will answer them all.


      Mode of transportation  


    We mainly adopt dedicated logistics and FedEx transportation methods, which can ensure timely shipment, quick delivery, stable logistics tracking, and safe and punctual delivery.

    Shop Lemon bottle High quality, in stock, fast delivery-Detailed Image 9 Shop FM2 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 12

    Certificates
    • NP810 High quality, extremely useful. close your eyes and buy directly Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    polypeptide,GHK-CU,NAD+,Tirzepatide,GLutathione

    Location:

    Room 5003, 5/F, Lee Yu Centre, 45 Hoi Yuen Road, Kwun Tong, Hong Kong

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.