Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 LL-37
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37   LL-37 buy - large image1
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37   LL-37 buy - image1
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37   LL-37 buy - image2
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37   LL-37 buy - image3
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37   LL-37 buy - image4
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37   LL-37 buy - image5
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37   LL-37 buy - image6

Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 LL-37

TDS 1 Inquiries

Unit Price:

$93-103/BOU FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GuangZhou

Packaging:

10vials/box

Price valid (until):

2026-09-30

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides,Semagiutide,Retatrutide,GHK-CU,MOTS-c,Semax

  • Product Description

  • Seller Information

  • Inquiry History

  • Description



    Sales manager:  Hailey

    WHATSAPP:+     85247010364
    EMAIL:  874869045@qq.com

    S incerely look forward to your inquiries about our products.  Selank peptide is a synthetic peptide that has been gaining popularity in recent years due to its numerous health benefits. With all the talk of people using Selank peptide recently, many are still wondering about the benefits of it and what it actually does. We'll be going over the numerous potential health benefits of this peptide therapy.

    Items Specifications

    Product Name   

     LL-37

    CAS 

    154947-66-7
    Molecular Formula C205H340N60O53
    color White
    Form Solid freeze-dried powder
    Storage condition  -20°C
    Purity     99%  
     Packaging Bottle, Can, Drum, Plastic Container, Vacuum Packet (According to customers' requirements)  
     Trademark Customzied accepted   

    Shop Selank OEM Available Factory Direct Peptide Supplier 5mg 10mg-Detailed Image 1 Shop Selank OEM Available Factory Direct Peptide Supplier 5mg 10mg-Detailed Image 2 Shop Selank OEM Available Factory Direct Peptide Supplier 5mg 10mg-Detailed Image 3 Shop Selank OEM Available Factory Direct Peptide Supplier 5mg 10mg-Detailed Image 4 Shop Selank OEM Available Factory Direct Peptide Supplier 5mg 10mg-Detailed Image 5 Shop Selank OEM Available Factory Direct Peptide Supplier 5mg 10mg-Detailed Image 6 Shop Selank OEM Available Factory Direct Peptide Supplier 5mg 10mg-Detailed Image 7



    1.Mass production customize available.

    2.Vial size and mg content size customize

    3.Shipping channels secure.

    4. Vaccum seal for all of vials.

    5. Fresh batch every 6-8 days.

    Product advantages

    Why Partner with us?


    Quality Assurance:

    Manufactured in GMP-certified facilities with full traceability and regulatory-aligned documentation.

    Flexible Supply:

    Available in multiple formats. Consistent lead times with flexible production capacity.

    Competitive Edge:

    Factory-direct pricing with volume discounts; stable supply chain to meet your market demand.

    Technical Support:

    Full documentation and formulation guidance.


    FAQ

    Q: How about the price? Can you make it cheaper?
    A: We always take the customer's benefit as the top priority. Price is negotiable under different conditions, we are assuring you to get the most competitive price.

    Q. What's the lead time and shipping ways?
    A: We will delivery to the package by USPS, FEDEX, DHL paket and other dedicated transportation to you after receive your payment, it would take around 10-15 workdays to your address.

    Q: How do i keep the peptides when i receive it ?
    A: Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.


    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1972 Inquiries-Detailed Image 1 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1972 Inquiries-Detailed Image 2 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1972 Inquiries-Detailed Image 3



    Product Function

     


    1.Helps slow food leaving your stomach

    2.Helps the pancreas produce more insul when your blood sugar levels are high

    3.Can reduce hyperglycemia, especially after meals

    4.Has been shown to lower triglyceride levels and oxidative stress from high LDL

    5.Helps prevent your liver from making too much sugar

    6.Can help control blood glucose

    7.Can reduce fasting insul and fasting glucose

    8.Can decrease appetite and caloric intake, while inhibiting weight gain


    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1972 Inquiries-Detailed Image 4





    Shipping WayShop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1972 Inquiries-Detailed Image 5



    Payment Methods

     



    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1972 Inquiries-Detailed Image 6




    Why Choose Us

    1.Our company strictly follows relevant national standards and specifications from raw material selection, production and processing to finished product packaging to ensure product quality and safety.

    2.We are manufacturer and can provide high quality products with factory price.

    3.All purity>99%.

    4.Parcel can be sent out in 24 hours after payment tracking number available.





    Q1: May I get one sample before placing order?

    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.

    Q2: Which payment is available for your company?

    Re: T/T, PayPal,bank transfer etc. You can choose the one which is convenient for you.

    Q3: How and when can I get my goods after payment?

    Re: For small quantity products, they will be delivered to you by international courier(DHL, FedEx, TNT etc.) or by air. Usually it will cost 5-7days that you can get the goods after delivery.For large quantity products, shipping by see is worthwhile.It will cost 15 to 30 days to come to your destination port, which depends on where the port is.

    Q4: Is there any possible to use my appointed label or package?

    Re: Yes. If needed, we'd lik



    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1972 Inquiries-Detailed Image 10
    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1972 Inquiries-Detailed Image 11
    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1972 Inquiries-Detailed Image 12
    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1972 Inquiries-Detailed Image 13
    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1972 Inquiries-Detailed Image 11 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1972 Inquiries-Detailed Image 12


    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides,Semagiutide,Retatrutide,GHK-CU,MOTS-c,Semax

    Location:

    Units 1503-14, 15th Floor, New HNA Building, No. 7 Guoxing Avenue, Lantian Subdistrict, Meilan District, Haikou City, Hainan Province

    Payment Terms:

    TT against copy of documents,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    3

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    101-200

    Year of Establishment:

    2025

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.