Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > CAS 154947-66-7 High Purity LL37 Peptides, Top Quality Raw Powder, Factory Direct Wholesale
CAS 154947-66-7 High Purity LL37 Peptides, Top Quality Raw Powder, Factory Direct Wholesale buy - large image1
CAS 154947-66-7 High Purity LL37 Peptides, Top Quality Raw Powder, Factory Direct Wholesale buy - image1
CAS 154947-66-7 High Purity LL37 Peptides, Top Quality Raw Powder, Factory Direct Wholesale buy - image2
CAS 154947-66-7 High Purity LL37 Peptides, Top Quality Raw Powder, Factory Direct Wholesale buy - image3
CAS 154947-66-7 High Purity LL37 Peptides, Top Quality Raw Powder, Factory Direct Wholesale buy - image4
CAS 154947-66-7 High Purity LL37 Peptides, Top Quality Raw Powder, Factory Direct Wholesale buy - image5
CAS 154947-66-7 High Purity LL37 Peptides, Top Quality Raw Powder, Factory Direct Wholesale buy - image6

CAS 154947-66-7 High Purity LL37 Peptides, Top Quality Raw Powder, Factory Direct Wholesale

TDS 3 Inquiries

Unit Price:

$10/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HongKong

Brand:

Tranmoo

Packaging:

5mg*10vials

Price valid (until):

2026-12-10

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Contact Information:
    WHATSAPP:+8615875350252

    EMAIL:cting7458@gmail.com

    please add my WhatsApp account to receive more product catalogs!


    1. Company Introduction:

    Our company specializes in exporting various chemical products, including chemical raw materials, a full range of peptide products.

    We will provide you with high quality products at the best offer. Professional transportation, convenient and safe, door-to-door delivery.

    Customers who have ordered our products(peptides)have had very good feedback.

    World wide relaible buyers can contact us about the peptides.

    2. Product Description:

    LL‑37 is the only human cathelicidin antimicrobial peptide, derived from the hCAP18 protein. It is a 37‑amino acid cationic, amphipathic α‑helical peptide with broad immunomodulatory and host defense functions.
    CAS Number: 154947-66-7
    It exhibits potent antimicrobial activity against Gram‑positive and Gram‑negative bacteria, fungi, and enveloped viruses. Beyond direct microbial killing, LL‑37 regulates inflammation, promotes wound healing, modulates immune cell recruitment, and supports tissue repair. It is widely studied in immunology, dermatology, infection research, and mucosal defense.

    Production:
    Manufactured via solid-phase peptide synthesis (SPPS), followed by purification and lyophilization to obtain the final product.


    NOTE: This product was prepared by chemical synthesis. Used only for research. Not for human use.



    3. Key Categories:

    - Cosmetic Peptides: Acetyl Hexapeptide-8, Copper Peptide GHK-Cu, Pentapeptide-4, SNAP-8
    - Pharmaceutical Peptides: Semaglutide, Tirzepatide, Thymosin Alpha-1, Epithalon

    4. Specifications:

    Name: LL37 5mg

    CAS No.: 154947-66-7

    Purity: >99% (or refer to the Certificate of Analysis)

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Shelf Life: >2 years if stored properly

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).



    5.  Applications:

    1. LL37 has been used as an antimicrobial agent to improve wound healing.

    2. LL37 has been used as a vaccine adjuvant to enhance the immune response of vaccines.

    3. LL37 has been used as a therapeutic agent for the treatment of inflammatory diseases such as asthma and cystic fibrosis.

    4. LL37 has been used as an immunomodulator to modulate the immune response and enhance the production of pro-inflammatorycytokines and chemokines.

    5. LL37 has been studied as a potential target for cancer therapy, due to its ability to induce apoptosis and inhibit cancer cell growth.

    6. LL37 has been studied as a potential target for antiviral therapy due to its ability to inhibit the replication of viruses.




    6. Why Choose Us:

    Rich Industry Experience:

    1. We are a long-established leading professional manufacturer in China’s pharmaceutical industry. Our products are exported to Germany, Spain, the United Kingdom, the United States, Australia, the Middle East and numerous other regions worldwide. We have received consistent positive feedback from clients and built long-term, amicable cooperative partnerships.

    2. Superior Quality, High Purity & Competitive Pricing:
    3. Premium quality is the core of our competitive advantage. Sample orders are welcome, with a minimum order quantity (MOQ) of only 1 gram.

    4. Secure & Expedited Delivery:
      We maintain sufficient in-house inventory, enabling same-day shipment upon receipt of payment.

      We have dedicated logistics channels for shipments ranging from 0.01 kg to 3.5 kg per consignment. We also provide custom dissolving service to convert solid powder into liquid formulations, which will be packed in specialized sealed bottles for transportation.

    5. Comprehensive After-sales Support:
      We will proactively update you with real-time shipping tracking information. Our team will make every effort to resolve any issues our customers may encounter.

    Contact us for best quotation!




    7. peptides have obvious advantages:

    Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions

    8.Main Functions & Benefits

    Unlike conventional antibiotics, LL-37 acts on conserved membrane lipid components rather than specific microbial enzymes or ribosomes, making it a valuable model for studying mechanisms of antibiotic resistance avoidance and innate immune activation. Its dual role—simultaneous antimicrobial action and immunomodulatory signaling—allows researchers to investigate multicellular innate responses, epithelial barrier function, and peptide‑mediated modulation of TLR signaling and autophagy in a single system; it also demonstrates measurable activity in serum‑containing media at micromolar concentrations and is amenable to site‑directed analog design for structure–activity relationship studies.




    FAQ:

    Q1: About the after-sale service

    A: After purchasing the products from our Lab, we have A professional technical team and after-sales team to serve you and solve all your problems in the future

    Q2: How do I start paying?
    Payment methods: USDT, Paypal Bitcoin, bank transfer, Alipay, and WeChat Pay.

    Q3: How to confirm product quality before placing an order?
    You can send us your product specifications and requirements and we can customize for you.

    Q4: What is your MOQ?
    A: The minimum quantity we can order is 1 box.

    Q5: How is the quality I want to test.
    A: Before production and extraction, we will test all raw materials.Quality is our top priority.All products are strictly tested and confirmed by our QC and QA, approved by Third Party Lab in China.So you will be assured with Good Quality if you choose us. We welcome you test the product and hope to get your feedback.

    Q6 : Have you received my payment How long will it take
    A: Generally, we can receive your payment the next day, and we will inform you as soon as we receive your payment.
    After confirmation payment, we will send out package

    Q7:When will you sent out the goods after successful payment
    A: Normally the order will be delivery within 1-3 days after the order confirmed, except the customized products.

    Q8:What modes of transportation do you have to choose
    A: We cooperate with HKEMS, DHL, TNT, UPS, FEDEX, EMS, China Air Post ,sea transportation etc.
    And with the SAFE SHIPPING in each country, you can receive the goods smoothly.It is fast and safe method.

    Q9:How long does it take to the goods arrived
    A: It is Depending on your location:
    For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, HKEMS,Netherlands post.
    For large order, please allow 5-8 days by Air, 20-35 days by Sea
    At the same time, we have warehouses in Germany and California, and some orders can be sent directly from Germany or California.

    Q10: How is the goods packed
    A: We usually send goods with disguise package outside and a double-layer sterile transparent bag inside.We have tried thousand of package methods, it looks serious and discreet.


    Shop Factory Wholesale LL37 PeFactory Wholesale LL37 Peptide 5mg154947-66-7 High Qualityptide 5mg154947-66-7 High Quality-Detailed Image 1 Shop Factory Wholesale LL37 PeFactory Wholesale LL37 Peptide 5mg154947-66-7 High Qualityptide 5mg154947-66-7 High Quality-Detailed Image 2 Shop Factory Wholesale LL37 PeFactory Wholesale LL37 Peptide 5mg154947-66-7 High Qualityptide 5mg154947-66-7 High Quality-Detailed Image 3 Shop Factory Wholesale LL37 PeFactory Wholesale LL37 Peptide 5mg154947-66-7 High Qualityptide 5mg154947-66-7 High Quality-Detailed Image 4 Shop Factory Wholesale LL37 PeFactory Wholesale LL37 Peptide 5mg154947-66-7 High Qualityptide 5mg154947-66-7 High Quality-Detailed Image 5 Shop Factory Wholesale LL37 PeFactory Wholesale LL37 Peptide 5mg154947-66-7 High Qualityptide 5mg154947-66-7 High Quality-Detailed Image 6

    Shop Factory Wholesale LL37 PeFactory Wholesale LL37 Peptide 5mg154947-66-7 High Qualityptide 5mg154947-66-7 High Quality-Detailed Image 7 Shop Factory Wholesale LL37 PeFactory Wholesale LL37 Peptide 5mg154947-66-7 High Qualityptide 5mg154947-66-7 High Quality-Detailed Image 8 Shop Factory Wholesale LL37 PeFactory Wholesale LL37 Peptide 5mg154947-66-7 High Qualityptide 5mg154947-66-7 High Quality-Detailed Image 9
    Shop Factory Wholesale LL37 PeFactory Wholesale LL37 Peptide 5mg154947-66-7 High Qualityptide 5mg154947-66-7 High Quality-Detailed Image 10
    Shop Factory Wholesale LL37 PeFactory Wholesale LL37 Peptide 5mg154947-66-7 High Qualityptide 5mg154947-66-7 High Quality-Detailed Image 11

    Items Specifications
    Before ordering Please send what items and what quantity you need
    Send quotation We will send you a quotation in detail with total
    Payment ways chosen Please choose one of the payment way you preferred.
    Payment methods: USDT, Bitcoin, bank transfer, Alipay, and WeChat Pay.
    After payment Please offer shipping address after payment for shipment.
    Tracking We will provide the tracking after goods sent
    After-sale service Available always



    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    CAS 154947-66-7 High Purity LL37 Peptides, Top Quality Raw Powder, Factory Direct Wholesale is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide

    Location:

    shenzhenshilonggangqulongchengjiedaohuanggekengshequjiazhaoyeshidaidasha902

    Average lead Time:

    15

    Year of Establishment:

    2024

    Shenzhen Chuanmu Technology Co., Ltd .

    Shenzhen Chuanmu Technology Co., Ltd. stands at the forefront of the biotechnology industry as a specialized leader dedicated to the research, development, and sales of high-purity, bioactive peptides. We integrate cutting-edge scientific innovation with an unwavering commitment to quality, serving a global clientele across pharmaceuticals, cosmetics, nutraceuticals, and research institutions.

    Driven by a mission to harness the power of peptides for health and advancement, our core strength lies in our advanced R&D capabilities. Our team of expert scientists utilizes state-of-the-art synthesis, purification, and analytical technologies to produce peptides of exceptional purity, consistency, and biological activity. We offer a comprehensive portfolio, including custom peptide synthesis, catalog peptides, generic APIs, and novel peptide-based formulations tailored to specific client requirements.

    Quality and reliability are the bedrock of our operations. Our processes adhere to the most stringent international standards, ensuring every product meets rigorous specifications for safety and efficacy. We are more than just a supplier; we are a strategic partner, providing robust technical support, confidential collaboration, and scalable solutions from preclinical stages to commercial production.

    Based in the dynamic innovation hub of Shenzhen, China, Shenzhen Chuanmu Technology is poised to accelerate your next breakthrough. We empower our partners to pioneer new treatments, enhance product performance, and push the boundaries of scientific discovery.

    Our Promise: Precision in Every Chain. Innovation for a Healthier Future.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.