Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > PEPTIDE YY, HUMAN for Sale > Hot Sale Peptide Pharmacy Grade H12 Factory price Betty
Hot Sale Peptide Pharmacy Grade H12 Factory price Betty buy - large image1
Hot Sale Peptide Pharmacy Grade H12 Factory price Betty buy - image1
Hot Sale Peptide Pharmacy Grade H12 Factory price Betty buy - image2
Hot Sale Peptide Pharmacy Grade H12 Factory price Betty buy - image3
Hot Sale Peptide Pharmacy Grade H12 Factory price Betty buy - image4
Hot Sale Peptide Pharmacy Grade H12 Factory price Betty buy - image5
Hot Sale Peptide Pharmacy Grade H12 Factory price Betty buy - image6

Hot Sale Peptide Pharmacy Grade H12 Factory price Betty

Unit Price:

$5/UNIT FOB

Get Latest Price
CAS No.:

118997-30-1

Grade:

Pharmaceutical

Content:

99%

Port:

HongKong

Packaging:

10vial

Price valid (until):

2026-11-02

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,NAD+,Samaglutide,GHK-CU,cagrilintide

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    We produce various peptides. Please feel free to inquire.


    Contact us

    Contact us: Whatsapp:+852 9184 0124

    Product Detail  



    Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 2

    Under ideal, controlled conditions, Adipotide once showed promising advantages:

    1. Highly Targeted and Direct:​ Unlike general weight-loss drugs that work systemically by suppressing appetite or boosting metabolism, it directly "destroys" the fat tissue itself, theoretically making it more efficient.

    2. Potentially Fast-Acting:​ In monkey studies, significant body fat reduction was observed within weeks.


      Product Detail  


    Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 3 Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 4 Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 5 Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 6 Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 7


      Our main products include peptide products and pharmaceutical raw materials. We boast strong R&D capabilities, superb synthesis technology, and advanced quality control methods. We actively promote joint ventures and cooperation with major enterprises and manufacturers, serving society and users with the concept of industrial development. We always adhere to market demand orientation and continuously develop new high-tech chemical products and pharmaceutical intermediates.

         I am very confident in the quality of our products, and many foreign customers have given high praise after receiving our goods. Our products are of excellent quality, and we firmly guarantee door-to-door delivery of your orders.


    Corporate Culture:Strive for survival by quality, strive for development by competition


    Corporate Philosophy:We always adhere to "integrity-based, customer first, high quality and efficiency" as the concept, based on "excellent quality, transparent price, punctual delivery, professional service" as the principle, meanwhile we can and will do our best to provide customers with the best service to repay customers.


      Packaging Process:   


    Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 8


      FQA  


    Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 9

    Samaglutide Product Introduction

    I. Basic Information
    Name: Samaglutide
    CAS No.: 910463-68-2
    Molecular Formula: C₁₈₇H₂₉₁N₄₅O₅₉
    Molecular Weight: 4113.58 Da
    Structure: Long-acting GLP-1 receptor agonist, fatty acid modified, half-life approximately 7 days

    Appearance: White lyophilized powder
    Purity: ≥99% (HPLC-MS)

    II. Mechanism of Action (GLP-1 monoreceptor agonist)
    Glucose Control: Glucose-dependent insulinotropic effect, glucagon inhibition
    Weight Loss: Delays gastric emptying, potent appetite suppression, reduces calorie intake
    Cardiovascular Protection: Reduces the risk of major adverse cardiovascular events 

    III. Core Efficacy
    Weight Loss 
    STEP 1: Average weight loss over 68 weeks 14–15% (approximately 15.5 kg)

    Over 80% fat loss, muscle preservation

    Blood sugar reduction 

    Type 2 diabetes: HbA1c reduction of 1.5–2.0%

    Improved metabolism

    Benefits include lowering blood pressure, improving blood lipids, and reducing fatty liver

    Cardiovascular benefits

    SELECT trial: 20% reduction in MACE risk in overweight/obese individuals

    Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 10


      Handling and Storage  


    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

    Peptide YY (PYY) is a gut hormone that regulates appetite and inhibits pancreatic secretion. Peptide YY (PYY) can mediate its effects through the Neuropeptide Y receptors.
    Research & Reference Note

    Hot Sale Peptide Pharmacy Grade H12 Factory price Betty is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    PEPTIDE YY, HUMAN

    Other Name:

    H-TYR-PRO-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2;PEPTIDE YY PYY HUMAN;PEPTIDE TYROSINE TYROSINE, HUMAN;PEPTIDE YY, HUMAN;PYY (HUMAN);TYR-PRO-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2;YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2;PYY,Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2

    CAS No.:

    118997-30-1

    Molecular Formula:

    C194H295N55O57

    InChIKeys:

    YNXLOPYTAAFMTN-SBUIBGKBSA-N

    Molecular Weight:

    4309.75

    Exact Mass:

    4309.194

    Characteristics
    PSA:

    1830

    Storage Conditions:

    −20°C

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,NAD+,Samaglutide,GHK-CU,cagrilintide

    Location:

    1502A1, Building 4, Xinyuanxin Center, No. 3 Huaxin Road, Dongfeng Street, Licheng District, Jinan City, Shandong Province

    Payment Terms:

    TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    1

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    51-100

    Year of Establishment:

    2026

    Certifications:

    COA,COA,COA,COA,COA,COA,COA,COA,COA,COA,COA,COA

    COMPANY INTRODUCTION

    20 years of dedicated work in the peptide industry

    15 Years of Industry Experience

    We have been a high-tech company focused on the development, production, and marketing of various peptide products

     for 15 years. Through advanced laboratories and strict quality control, our internationally certified products are safe and 

    effective.


    Clients in Europe, the USA, Southeast Asia, and the Middle East

    As a global trading company, we serve clients across Europe, the USA, Southeast Asia, the Middle East, and beyond, providing

     customized solutions. Committed to "technology leading Health", we aim to innovate and deliver high-quality health products 

    worldwide.


    3,000sqm Factory with 60 Employees

    We have a factory covering 3,000 square meters and housing 60 employees to guarantee the highest quality all the time. We hired 

    three quality auditors with three years of experience. They meticulously inspect each item at every production stage.


    Contact Us Now

    Our products are exported to more than 130 countries and regions, which can be delivered fast within 5-14 days. We can provide

     OEM/ODM support to our customers. We have 10 professional after-sales staff to make 24-hour responses to our customers. 

    Contact us now to learn more. We hope to establish stable and strategic long-term business relationships with domestic and 

    foreign suppliers and customers, jointly pursuing a better future.


  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.