Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > PEPTIDE YY, HUMAN for Sale > Hot Sale Peptide Pharmacy Grade H12 Factory price
Hot Sale Peptide Pharmacy Grade H12 Factory price buy - large image1
Hot Sale Peptide Pharmacy Grade H12 Factory price buy - image1
Hot Sale Peptide Pharmacy Grade H12 Factory price buy - image2
Hot Sale Peptide Pharmacy Grade H12 Factory price buy - image3
Hot Sale Peptide Pharmacy Grade H12 Factory price buy - image4
Hot Sale Peptide Pharmacy Grade H12 Factory price buy - image5
Hot Sale Peptide Pharmacy Grade H12 Factory price buy - image6

Hot Sale Peptide Pharmacy Grade H12 Factory price

TDS

Unit Price:

$50-55/UNIT FOB

Get Latest Price
CAS No.:

118997-30-1

Grade:

Pharmaceutical Grade

Content:

99%

Port:

香港

Brand:

STTY

Packaging:

10 iu, 10vial/kit

Price valid (until):

2027-01-09

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    We produce various peptides. Please feel free to inquire.

    WhatsApp:+852 6564 4944

    Email:1491037192@qq.com


      Main Function 


    Overview:
    GHRP-2 is a synthetic peptide that stimulates the pituitary gland to release growth hormone (GH). It is widely studied for its potential to enhance muscle growth, improve fat metabolism, and support recovery.

    Mechanism of Action:

    • Binds to growth hormone secretagogue receptors (GHS-R1a) in the pituitary
    • Stimulates pulsatile secretion of GH, promoting:
      • Muscle protein synthesis
      • Fat breakdown and metabolism
      • Tissue repair and recovery
    • May also have indirect effects on immune function and metabolism

    Potential Applications:

    • Muscle Growth & Strength: Supports lean muscle development
    • Fat Loss / Body Composition: Enhances fat metabolism through GH pathways
    • Recovery & Anti-Aging: Aids in tissue repair and post-exercise recovery
    • Research Use: Investigated for GH deficiency, metabolic disorders, and muscle wasting

    Key Advantages:

    • Strong GH stimulator, with controlled dosing possible due to short half-life
    • Supports both lean mass increase and fat reduction
    • Widely used in research and clinical investigations
    Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 1


      Advantage  


    Glutathione Key Functions 

    Skin Whitening & Brightening:Inhibits melanin synthesis by reducing tyrosinase activity, fading dark spots and evening skin tone.Neutralizes free radicals that contribute to pigmentation disorders like melasma.

    Antioxidant Defense:Scavenges reactive oxygen species (ROS) from UV exposure and pollution, preventing collagen degradation and premature aging.Protects skin lipids and DNA from oxidative damage.

    Anti-Inflammatory Effects:Reduces redness and irritation caused by acne, eczema, or post-procedure inflammation.Calms skin sensitivity and itching.

    Hydration & Skin Barrier Support:Improves skin moisture retention by enhancing the stratum corneum’s lipid barrier.Promotes a smoother, plumper complexion.

    Hair Health:Combats oxidative stress in hair follicles, reducing breakage and graying.Supports scalp health and keratin production.

    Glutathione   Mechanism of Action

    Direct Radical Scavenging:Glutathione’s thiol group directly neutralizes free radicals, breaking oxidative chain reactions.

    Indirect Antioxidant Support:Regenerates other antioxidants like vitamins C and E, amplifying their effects.

    Melanin Regulation:Inhibits tyrosinase, the enzyme critical for melanin production, without cytotoxicity.

    Cellular Detoxification:Binds to heavy metals and toxins, aiding their elimination from the skin.

    W hich type personal care products can be found  Glutathione

    Whitening Serums & Creams: Targeted formulas for hyperpigmentation and uneven tone.

    Anti-Aging Products: Wrinkle-reducing creams and firming masks.

    Sensitive Skin Lines: Calming cleansers and post-procedure recovery gels.

    Sunscreens: Added to SPF products to boost UV protection and reduce photoaging.

    Anti-Graying Treatments: Scalp serums and hair masks to delay graying.

    Damage-Repair Formulas: Shampoos and conditioners for chemically treated or heat-damaged hair.

    Brightening Body Lotions: Targets dark elbows/knees and overall skin radiance.

    Detoxifying Bath Products: Cleanses and rejuvenates skin through antioxidants.



      Product Detail  


    Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 2

    Under ideal, controlled conditions, Adipotide once showed promising advantages:

    1. Highly Targeted and Direct:​ Unlike general weight-loss drugs that work systemically by suppressing appetite or boosting metabolism, it directly "destroys" the fat tissue itself, theoretically making it more efficient.

    2. Potentially Fast-Acting:​ In monkey studies, significant body fat reduction was observed within weeks.


      Product Detail  


    Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 3 Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 4 Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 5 Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 6 Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 7


      Our main products include peptide products and pharmaceutical raw materials. We boast strong R&D capabilities, superb synthesis technology, and advanced quality control methods. We actively promote joint ventures and cooperation with major enterprises and manufacturers, serving society and users with the concept of industrial development. We always adhere to market demand orientation and continuously develop new high-tech chemical products and pharmaceutical intermediates.

         I am very confident in the quality of our products, and many foreign customers have given high praise after receiving our goods. Our products are of excellent quality, and we firmly guarantee door-to-door delivery of your orders.


    Corporate Culture:Strive for survival by quality, strive for development by competition


    Corporate Philosophy:We always adhere to "integrity-based, customer first, high quality and efficiency" as the concept, based on "excellent quality, transparent price, punctual delivery, professional service" as the principle, meanwhile we can and will do our best to provide customers with the best service to repay customers.


      Packaging Process:   


    Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 8


      FQA  


    Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 9

    Samaglutide Product Introduction

    I. Basic Information
    Name: Samaglutide
    CAS No.: 910463-68-2
    Molecular Formula: C₁₈₇H₂₉₁N₄₅O₅₉
    Molecular Weight: 4113.58 Da
    Structure: Long-acting GLP-1 receptor agonist, fatty acid modified, half-life approximately 7 days

    Appearance: White lyophilized powder
    Purity: ≥99% (HPLC-MS)

    II. Mechanism of Action (GLP-1 monoreceptor agonist)
    Glucose Control: Glucose-dependent insulinotropic effect, glucagon inhibition
    Weight Loss: Delays gastric emptying, potent appetite suppression, reduces calorie intake
    Cardiovascular Protection: Reduces the risk of major adverse cardiovascular events 

    III. Core Efficacy
    Weight Loss 
    STEP 1: Average weight loss over 68 weeks 14–15% (approximately 15.5 kg)

    Over 80% fat loss, muscle preservation

    Blood sugar reduction 

    Type 2 diabetes: HbA1c reduction of 1.5–2.0%

    Improved metabolism

    Benefits include lowering blood pressure, improving blood lipids, and reducing fatty liver

    Cardiovascular benefits

    SELECT trial: 20% reduction in MACE risk in overweight/obese individuals

    Shop CAS Quality Peptides Raw Powder Factory Supply Weight Loss Adipotide-Detailed Image 10


      Handling and Storage  


    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

    Certificates

    Basic Info
    Product Name:

    PEPTIDE YY, HUMAN

    Other Name:

    H-TYR-PRO-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2;PEPTIDE YY PYY HUMAN;PEPTIDE TYROSINE TYROSINE, HUMAN;PEPTIDE YY, HUMAN;PYY (HUMAN);TYR-PRO-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2;YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2;PYY,Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2

    CAS No.:

    118997-30-1

    Molecular Formula:

    C194H295N55O57

    InChIKeys:

    YNXLOPYTAAFMTN-SBUIBGKBSA-N

    Molecular Weight:

    4309.75

    Exact Mass:

    4309.194

    Characteristics
    PSA:

    1830

    Storage Conditions:

    −20°C

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide

    Location:

    Room 1501, Building 1, Changnan Mansion, Country Garden, on the west side of Taoyang North Road

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    11

    Year of Establishment:

    2025

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.