Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 | Tong Peptides | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder
LL37 |  Tong Peptides | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - large image1
LL37 |  Tong Peptides | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image1
LL37 |  Tong Peptides | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image2
LL37 |  Tong Peptides | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image3
LL37 |  Tong Peptides | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image4
LL37 |  Tong Peptides | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image5
LL37 |  Tong Peptides | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image6

LL37 | Tong Peptides | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder

3 Inquiries

Unit Price:

$90-100/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GuangZhou

Brand:

Tong Peptides

Packaging:

10mg/vial,10vials/box

Price valid (until):

2026-09-06

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

retatrutide,TB-500,GHK-CU,peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Details  

                                                                                                                                                           Name : Joyce

                                                                                                                     Whatsapp/wechat: +852 6571 4890

                                                                                                                        Email: joyce@tongpeptides.com

    Whenever possible, after the product is dissolved, you should apply it to your experiment on the same day. However, if you need to do pre-experiment in advance, or if you need to completely dissolve it, we suggest that you store the solution in an aliquot in a sealed vial at -20℃. Usually, these can be used for up to two weeks. Before use, before opening the sample bottle, we recommend that you balance the product to room temperature for at least 1 hour

    Shop Tong Peptide Powder Ghk-Cu with Best Price and High Quality-Detailed Image 2
    Shop Tong Peptide Powder Ghk-Cu with Best Price and High Quality-Detailed Image 3

    Why Choose Us

    We own self‑operated factories specializing in the large‑scale production of pharmaceutical intermediates, organic intermediates and other raw materials. Our products are widely applied across pharmaceuticals, health‑care products, cosmetics, nutritional supplements and food additives.
    Upholding the business philosophy of integrity‑based cooperation, scientific innovation and service priority, we place top priority on reliable product quality and build a comprehensive service system. We deliver responsive, high‑quality consultation services to meet your requirements. We sincerely welcome your inquiries and look forward to forging partnerships with you for shared growth and a promising future.


    Shop Tong Peptide Powder Ghk-Cu with Best Price and High Quality-Detailed Image 4

    Key Products

    We specialize in multiple peptide product lines, covering weight‑management peptides, pharmaceutical‑grade peptides, cosmetic‑use peptides and custom‑synthesized peptides. Our key weight‑loss peptide portfolio includes Semaglutide, Tirzepatide, Retatrutide and more related compounds.

    Clinical Performance

    Retatrutide has exhibited impressive therapeutic outcomes in clinical investigations. Data from a recent Phase 3 clinical trial revealed pronounced weight‑loss effects among subjects administered Retatrutide. Within a 48‑week treatment cycle, test participants achieved an average body‑weight reduction of as much as 15%, outperforming many currently available anti‑obesity medications.
    Beyond weight‑lowering effects, Retatrutide delivers positive impacts on cardiovascular risk profiles. It helps optimize blood pressure, lipid parameters and inflammatory biomarkers, which in turn lowers the overall likelihood of cardiovascular‑related disorders.

    Company Profile

    Chongqing Best Biotechnology Co., Ltd. is a dynamic and forward‑thinking enterprise operating in the biotechnology space. We take “Quality Oriented, Customer Centric” as our core guideline. By strictly implementing high‑standard quality control and customer‑focused services, we keep promoting technological upgrading in the biotech industry.
    Driven by technical innovation and pursuit of high standards, our goal is to bring value to global healthcare. As a specialized manufacturer of peptide products, we are supported by an experienced R&D group made up of senior researchers and technical engineers. Our team keeps conducting technical exploration and product iteration, aiming to develop peptide solutions that are safer, higher‑efficiency and more competitive in global markets. Our main product scope covers weight‑management peptides, beauty‑use cosmetic peptides as well as custom peptide synthesis services. Our star weight‑loss peptide products include Tirzepatide, Semaglutide, Retatrutide and other related peptide compounds.
    We provide stable, time‑efficient custom production services for pharmaceutical APIs under strict quality management protocols. We maintain seamless communication throughout every project phase to meet individualized client demands. Backed by our professional sales force that prioritizes quality and after‑sales support, we have gained solid market achievements for years. We devote great efforts to developing overseas markets; our products are exported to a wide range of countries and regions including Europe, North America, Southeast Asia, the Middle East and Africa.
    We follow our business principle: “Put customers first, uphold good reputation, guarantee product quality, deliver professional services”. Our goods sell well both in domestic and international markets. We sincerely hope to establish stable long‑term cooperative relationships and achieve mutual growth with partners all over the world based on mutual benefits. Should you have any interest in our company or product offerings, please feel welcome to contact us for further information.

    Shop Tong Peptide Powder Ghk-Cu with Best Price and High Quality-Detailed Image 4 Shop Tong Peptide Powder Ghk-Cu with Best Price and High Quality-Detailed Image 5 Shop Tong Peptide Powder Ghk-Cu with Best Price and High Quality-Detailed Image 6

    Shop Tong Peptide Powder Ghk-Cu with Best Price and High Quality-Detailed Image 7
    Shop Tong Peptide Powder Ghk-Cu with Best Price and High Quality-Detailed Image 8
    Shop Tong Peptide Powder Ghk-Cu with Best Price and High Quality-Detailed Image 9
    Shop Tong Peptide Powder Ghk-Cu with Best Price and High Quality-Detailed Image 10
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL37 | Tong Peptides | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    retatrutide,TB-500,GHK-CU,peptide

    Location:

    1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    501-1000

    Year of Establishment:

    2023

    Pharma Grade Peptides is your premium source for high-quality purified research peptides.

    We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

    Over the course of many years, we have empowered researchers and scientists to
    explore new avenues of scientific discovery.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.