Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality peptide powder The Human Cathelicidin Antimicrobial Peptide...
LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality peptide powder The Human Cathelicidin Antimicrobial Peptide... buy - large image1
LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality peptide powder The Human Cathelicidin Antimicrobial Peptide... buy - image1
LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality peptide powder The Human Cathelicidin Antimicrobial Peptide... buy - image2
LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality peptide powder The Human Cathelicidin Antimicrobial Peptide... buy - image3
LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality peptide powder The Human Cathelicidin Antimicrobial Peptide... buy - image4
LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality peptide powder The Human Cathelicidin Antimicrobial Peptide... buy - image5
LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality peptide powder The Human Cathelicidin Antimicrobial Peptide... buy - image6

LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality peptide powder The Human Cathelicidin Antimicrobial Peptide...

TDS 3 Inquiries

Unit Price:

$100/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Hong Kong

Brand:

customizable

Packaging:

10vials/box

Price valid (until):

2027-12-25

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,Survodutide,GHK-CU,GLOW,KLOW

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    mailbox huangbobo33@outlook.com

    whatsapp +852 9500 9381

    telegram @Jkhunag


      Basic Info  


    Retatrutide is a triple glucagon, GIP, and receptor agonist. Retatrutide showed glucose control and weight loss in patients with type 2 diabetes mellitus (T2DM).Retatrutide (LY3437943) is a triple agonist peptide of the glucagon receptor (GCGR), glucosedependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor .Retatrutide can be used for the research of obesity.Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C.

    Function

    1.Treatment of depression and anxiety disorders: Retatrutide has been shown to have antidepressant and anxiolytic effects in preclinical studies, suggesting that it could be a promising treatment option for individuals with these conditions.

    2.Prevention of neurodegenerative diseases: Retatrutide has neuroprotective properties that may be useful in preventing or slowing the progression of neurodegenerative diseases such as Alzheimer's and Parkinson's.

    3.Enhancement of cognitive function: Retatrutide has been shown to improve learning and memory in animal studies, suggesting that it could have potential as a cognitive enhancer in humans.

    4.Treatment of chronic pain: Retatrutide has been shown to have analgesic effects in preclinical studies, suggesting that it could be a useful treatment option for individuals with chronic pain conditions.

    5.Promotion of wound healing:  Retatrutide  has been shown to accelerate wound healing in animal studies, suggesting that it could have potential as a therapeutic agent for promoting wound healing in humans.

    Application

    1.Retatrutide is often used in the pharmaceutical industry, weight losing, etc.

    2.Retatrutide is a kind of peptide product.

    3.Retatrutide acetate can inhibited GCGR, GIPR and GLP-1R.

    4.Retatrutide acetate is activated by glucagon receptors resulting in significant weight loss and increased energy expenditure.

    5.Retatrutide acetate can be used in studies of obesity.

    Product name

    Retatrutide

    CAS NO.

    2381089-83-2

     Purity

    99%

    Molecular weight

    4731.33

    Appearance

    White powder

    Molecular Formula

    C221H342N46O68

    Specifications

    Frozen

    Function

    Weight loss

    Storage

    Storage

    Function

    Weight loss


    Shop Factory Wholesale Cosmetic Peptides Retatrutide RT5 RT10 RT15-Detailed Image 1 Shop Factory Wholesale Cosmetic Peptides Retatrutide RT5 RT10 RT15-Detailed Image 2 Shop Factory Wholesale Cosmetic Peptides Retatrutide RT5 RT10 RT15-Detailed Image 3

    Shop Factory Wholesale Cosmetic Peptides Retatrutide RT5 RT10 RT15-Detailed Image 4


    company profile   


    Company Profile of Guangzhou Henghuang Trading Co., Ltd.
    Guangzhou Henghuang Trading Co., Ltd. specializes in the field of bioactive peptides. It integrates the supply of high-end peptide raw materials, the output of freeze-dried powder products, and personalized customized production. Based in the Guangdong-Hong Kong-Macao Greater Bay Area, it strives to provide high-standard raw materials and OEM solutions for the beauty and health industries, and empowers brand long-term development with cutting-edge biotechnology.
    The company carefully selects high-quality peptide raw materials, covering a full range of categories such as cosmetic peptides and functional active peptides. The purity of the raw materials strictly complies with the advanced industry standards, and the molecular activity is stable, meeting the diverse needs of product development. The freeze-dried powder is processed through a low-temperature vacuum freeze-drying process, which locks the activity of effective substances to the greatest extent. The quality is stable and suitable for various application scenarios such as hospital-line skincare, daily care products, and health derivatives. We deeply integrate upstream supply chain resources and collaborate with standardized production workshops. We can undertake the full chain services of formula development, formulation blending, specification customization, and packaging outsourcing, flexibly matching batch purchases and niche exclusive customization to meet the differentiated layout of customers.
    The enterprise strictly adheres to strict quality control standards, conducting rigorous verification at every step, from raw material entry, sample testing to product delivery. It firmly maintains the quality bottom line of safety and compliance. With the business philosophy of "craftsmanship for the long term, creating win-win outcomes", it relies on a mature supply chain system and technical service capabilities, while also considering product quality, delivery efficiency and cost advantages.

    Shop Peptide Mots-C CAS 1627580-64-6 Motsc Acetate Peptide Global shipping-Detailed Image 8

    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1852 Inquiries-Detailed Image 6 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1852 Inquiries-Detailed Image 7


    ProducTestingtion and 


    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1852 Inquiries-Detailed Image 8 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1852 Inquiries-Detailed Image 9 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1852 Inquiries-Detailed Image 10 Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1852 Inquiries-Detailed Image 11


    About Us   


    Why choose us? 1. We have a complete, stable and high-quality raw material supply chain, providing customers with high-quality products. 2. We have strict quality inspection procedures and professional certificate testing to ensure the quality level of the final products. 3. Our excellent sales team can provide customers with integrated and professional services. 4. We offer various OEM and ODM services to meet the different needs of different customers, with a low minimum order quantity. 5. Professional suppliers and manufacturers, an enterprise integrating production and sales, provides customers with one-stop services. Q&A
    1. Do you accept customization?
    Response: We can provide corresponding customized solutions based on the specific needs of our customers.
    2. Can you provide samples?
    Response: We can offer samples to our customers and send them to them via express delivery promptly.
    3. How is your production capacity? Can you meet the customers' demands in a timely manner? Regarding this, we can produce the products required by the customers on time and have sufficient production capacity.
    4. How long is your delivery cycle?
    For orders under 50 kilograms, they can be dispatched within 5 days. For orders over 50 kilograms, the corresponding time will be negotiated based on the weight of the products.
    5. What are your payment terms?
    Regarding payment: For amounts ≤ $1000, 100% payment is required in advance; for amounts ≥ $1000, 50% payment by wire transfer is required, and the remaining amount should be paid before shipment. Irrevocable sight letter of credit is applicable.
    6. Do you provide OEM or ODM services for the products?
    Yes, if needed, we can customize the products for you.
    7. How do you ensure that the goods provided meet the standards?
    All goods will be inspected before shipment. If the goods fail to meet our quality commitment, you can apply for a refund.
    8. How will you deliver the goods?
    Regarding: We have close cooperation with DHL, TNT, UPS, FEDEX, EMS, China Air Post. For container products, we can provide shipping services by sea. You can also choose your own freight forwarder. 

    Shop Top Quality Peptides Lyophilized Powder Tirzepatide Fitness and Weight Loss 1852 Inquiries-Detailed Image 12




    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality peptide powder The Human Cathelicidin Antimicrobial Peptide... is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality peptide powder The Human Cathelicidin Antimicrobial Peptide... Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,Survodutide,GHK-CU,GLOW,KLOW

    Location:

    Building 1, Floor 2, No. 96 Banhe Road, Huangpu District, Guangzhou City, Room 2164

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    12

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2026

    Certifications:

    COA,COA,COA,COA,COA

    Company Profile of Guangzhou Henghuang Trading Co., Ltd.
    Guangzhou Henghuang Trading Co., Ltd. specializes in the field of bioactive peptides. It integrates the supply of high-end peptide raw materials, the output of freeze-dried powder products, and personalized customized production. Based in the Guangdong-Hong Kong-Macao Greater Bay Area, it strives to provide high-standard raw materials and OEM solutions for the beauty and health industries, and empowers brand long-term development with cutting-edge biotechnology.
    The company strictly selects high-quality peptide raw materials, covering a full range of categories such as cosmetic peptides and functional active peptides. The purity of the raw materials strictly complies with the advanced industry standards, and the molecular activity is stable, meeting the diverse needs of product development. The freeze-dried powder is processed through a low-temperature vacuum freeze-drying process, which locks the activity of effective substances to the greatest extent. The quality is stable and suitable for various application scenarios such as hospital-line skincare, daily care products, and health derivatives. We deeply integrate upstream supply chain resources and collaborate with standardized production workshops. We can undertake the full chain services of formula development, formulation blending, specification customization, and packaging outsourcing, flexibly matching batch purchases and niche exclusive customization to meet the differentiated layout of customers.
    The enterprise strictly adheres to strict quality control standards, conducting rigorous verification at every step, from raw material entry, sample testing to product delivery. It firmly maintains the quality bottom line of safety and compliance. With the business philosophy of "craftsmanship for the long term, creating win-win outcomes", it relies on a mature supply chain system and technical service capabilities, while also considering product quality, delivery efficiency and cost advantages.
    Focusing on the market, Henghuang Trading adheres to a high-end positioning, deeply delving into the peptide raw materials and freeze-dried powder sectors, and continuously iterating the raw material categories and production processes. With stable supply, flexible customization, and professional technical support, it serves overseas and domestic cooperative merchants, collaborates with partners to deeply explore the efficacy market, builds a high-quality peptide industry ecosystem, and creates a reliable raw material and customization service provider in the industry.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.