 Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > Cagrilintide| TongPeptides | 99% Purity |CS

Cagrilintide| TongPeptides | 99% Purity |CS buy - large image1

Cagrilintide| TongPeptides | 99% Purity |CS buy - image1

Cagrilintide| TongPeptides | 99% Purity |CS buy - image2

Cagrilintide| TongPeptides | 99% Purity |CS buy - image3

Cagrilintide| TongPeptides | 99% Purity |CS buy - image4

Cagrilintide| TongPeptides | 99% Purity |CS

Name: Cagrilintide| TongPeptides | 99% Purity |CS
Brand: Tongpeptide
SKU: pr2608131266
Price: 17 USD
Availability: InStock

TDS 3 Inquiries

Unit Price:

$17/UNIT FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.5%

Port:

CHINA

Brand:

Tongpeptide

Packaging:

mg*10vials

Price valid (until):

2026-09-13

Contact Supplier

 Chat Now

Tong peptides

Company Type:

Manufactory

Location:

China

Qualification:

Main Products:

retatrutide,TB-500,GHK-CU,peptide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Descriptiopn

Name:Alice

Whatsapp:+852 5513 4538

Email:alice@tongpeptides.com

Name:Alice

Whatsapp:+852 5513 4538

Email:alice@tongpeptides.com

Cagrilintide is an innovative long-acting amylin analogue widely studied in modern metabolic wellness research. As a refined synthetic peptide compound, it uniquely targets amylin and calcitonin receptors, featuring a stable molecular structure and prolonged physiological activity. Unlike common GLP-1-based regulatory substances, Cagrilintide replicates the gentle metabolic modulation of natural amylin, an endogenous hormone that works in tandem with insulin to balance daily energy intake and consumption. This distinct working mechanism makes it a valuable research candidate for optimizing unbalanced metabolic conditions and supporting long-term physical wellness.
The core strength of Cagrilintide lies in its mild, multi-dimensional metabolic regulation. It gently moderates gastrointestinal emptying rhythm and extends natural satiety signals, helping users form steady and orderly eating habits while reducing unintended excessive energy intake. By tuning the body’s inherent energy balance pathways, it assists in improving cumulative energy surplus caused by sedentary lifestyles, irregular meal schedules and high-energy dietary patterns. This gradual, non-invasive conditioning effectively relieves chronic metabolic pressure and optimizes sub-health states linked to unbalanced energy metabolism.
Clinical observational research demonstrates that standardized cyclic use of Cagrilintide helps optimize body composition and enhance overall metabolic flexibility. It supports the natural adjustment of adipose tissue balance while preserving healthy muscle mass, maintaining a lean and stable physical state. Additionally, it assists in stabilizing daily glucose and lipid metabolism, improving the metabolic inertia commonly seen in modern sub-health populations. Its long-acting properties ensure sustained and steady physiological modulation, avoiding drastic physical fluctuations and enabling convenient long-term metabolic maintenance.
Possessing excellent long-acting properties, Survodutide adopts a convenient weekly conditioning cycle, which greatly simplifies daily metabolic management and suits long-term steady wellness maintenance. It presents a friendly tolerance profile in public research data with mild adaptive reactions and good physical compatibility for most users. Its unique dual-pathway regulation enables it to achieve more comprehensive metabolic balancing effects than single-mode regulatory substances.
It is clearly stated that all content above is summarized from public academic research and observational data, for scientific research and wellness reference only. Survodutide is a research-grade bioactive compound, not a daily nutritional product or medical treatment option. It cannot replace professional medical diagnosis and guidance. Individuals with special physical conditions or long-term health management plans are recommended to seek professional healthcare consultation before any exploratory use.

Shipping Method

Introduction to Our Factory

We are a professional and reliable peptide manufacturing factory in China, focusing on the R&D, production and supply of high-purity research-grade peptides and biochemical raw materials. Adhering to strict production standards and complete quality control systems, we are committed to providing cost-effective, high-quality peptide products and stable global supply services for international customers.

Quality is our core advantage. All our peptide products adopt advanced synthesis and purification technology, with universal HPLC purity over 99%. Every batch of goods undergoes strict laboratory testing, including high-performance liquid chromatography and mass spectrometry analysis. Complete test reports are provided to ensure stable ingredient content, low impurity rate and consistent product quality. All products are lyophilized and sealed in sterile independent vials to guarantee long-term stability during international transportation and storage.

Compared with other suppliers in the industry, we offer obvious price advantages. With independent production bases, standardized assembly lines and integrated supply chain management, we effectively reduce intermediate costs. We provide factory-direct wholesale prices while maintaining top-tier purity and quality, helping customers maximize profit margins with high cost performance.

Sufficient in-stock inventory covers mainstream peptide products, enabling rapid shipment within 1–3 working days after order confirmation. We have long-term cooperative professional freight teams, supporting stable and safe shipping to Europe, America, Southeast Asia, South America and other regions worldwide. With rich international export experience, our professional document sorting and standardized packaging greatly improve customs clearance pass rate, effectively avoiding customs detention risks and ensuring safe and smooth delivery of each order.

We always insist on standardized export procedures, stable quality control, competitive factory prices and efficient after-sales service, aiming to become your most trustworthy long-term peptide supply partner. All products are for laboratory research use only, not for human clinical use.

Q&A

Q1: Why should you buy from us instead of other suppliers?

A1: Because we are a factory, we can provide lower prices and guaranteed quality. We have extensive experience in domestic and foreign trade and provide services in an honest, timely and efficient manner.

Q2: When can I receive the package?

A2: It will be shipped as soon as possible after payment, and the shipping time is generally 7 to 12 days.

Q3: What is the minimum amount I can order?

A3: The minimum quantity we can order is 1 box, which contains 10vials.

Items Specifications

CS10
10ml*10vials

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Certificates
- TDS
Basic Info

Product Name:
LL-37

Other Name:
Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:
154947-66-7

Molecular Formula:
C205H340N60O53

InChIKeys:
POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:
0

EC Number:
211-519-9

Color/Form:
White to off-white

Categories:
Polypeptide

Characteristics

Water Solubility:
Soluble to 1 mg/ml in water

Research

Class:
Amylin receptor (AMYR) / calcitonin receptor (CTR) agonist (long-acting amylin analog)

Status:
Investigational — Phase 3 (REDEFINE program, CagriSema combination)

Mechanism:
A novel long-acting, acylated amylin (islet amyloid polypeptide, IAPP) analog consisting of 38 amino acids. Cagrilintide activates the amylin receptor (AMYR) and calcitonin receptor (CTR), reducing food intake, delaying gastric emptying, and promoting satiety. Being developed as monotherapy and in fixed-dose combination with semaglutide (CagriSema) for obesity. Administered once weekly.

Activity note:
Cagrilintide is a non-selective AMYR/CTR agonist. Specific EC50 values not publicly available; functional potency is comparable to native amylin at AMYR.

Source:
MCE: Cagrilintide (CAS 1415456-99-3); Novo Nordisk REDEFINE program.

Clinical Development:
NCT05249895; NCT05249882

References

PubChem:
PubChem

Literature:
MCE: Cagrilintide (CAS 1415456-99-3); ClinicalTrials.gov: REDEFINE-1 (NCT05249895); Novo Nordisk: EASD 2025 Cagrilintide data presentation

Disclaimer:
Cagrilintide is NOT FDA-approved or EMA-approved. It is in Phase 3 clinical trials (REDEFINE program). This listing is for industrial and laboratory research use only. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Seller Information

Business Type:
Manufactory

Main Products:
retatrutide,TB-500,GHK-CU,peptide

Location:
1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

Payment Terms:
TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Total Annual Revenue:
$10 million-$25 million

Total Employees:
501-1000

Year of Establishment:
2023

Pharma Grade Peptides is your premium source for high-quality purified research peptides.

We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

Over the course of many years, we have empowered researchers and scientists to
explore new avenues of scientific discovery.

Inquiry History

3 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Inventory is sufficient VIP5 SM2 Snap-8 G610 CU50 KLOW80 DS TSM10 MOTS KPV5	Cosmetics Grade/99	$1/G FOB	Chengtai Co., Ltd.	Inquiry
price moderate SLU-PP-322 RA10 MS40 NJ100 Snap-8 KS10 IP10 CBL60 GLOW70 CND10..	Pharmaceutical Grade/99	$80/UNIT FOB	Guangzhou Henghuang Trading Co., Ltd.	Inquiry
LL37 high purity 99% freeze dried powder cas154947-66-7 senwayer hot sales	Pharmaceutical Grade/99		Changsha Caoquan	Inquiry
Peptide White Powder LL-37 99% Purity LL37 Antimicrobial Peptide CAS:154947-66-7	Pharmaceutical Grade/99	$100-130/UNIT FOB		Inquiry
Antibacterial Protein LL-37 (human)	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry

Items	Specifications
CS10	*10ml10vials**

Cagrilintide| TongPeptides | 99% Purity |CS

Product Description

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches