Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99%
LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99% buy - large image1
LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99% buy - image1
LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99% buy - image2
LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99% buy - image3
LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99% buy - image4
LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99% buy - image5
LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99% buy - image6

LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99%

Unit Price:

$90-95/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

ShangHai

Brand:

HB

Packaging:

5mg /vial,10vials/box

Price valid (until):

2026-06-30

Company Type:
Trader
Location:
China
Qualification:
Main Products:

GLP-1,Retatrutide,Selank,Tirzepatide

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    Sales manager:Amy

    whatsapp/WeChat:+85296884746 

    Email:amy@yingliantech.cn

    Items Specifications
    Product Name LL37
    CAS No 154947-66-7
    Appearance White powder
    Purity 99.0%
    Specification size 5mg/vial,10vials/box
    1. LL-37 is the only known human Cathelicidin is a big protein family where the members exhibit diverse functions. These peptides, essentially produced by macrophages and polymorphonuclear leukocytes (both types of white blood cells), have bactericidal action. They have been found to have shown other substantial effects as well. The entire group is often referred to as antimicrobial peptides (AMPs). LL-37 in particular has been found to play significant roles in autoimmune disease, cancer, and wound healing

    2. Core product advantages:

      1. Human-derived, with extremely high biocompatibility: Derived from human peptides, it has no immunogenicity and is unlikely to cause allergic reactions. It can directly act on sensitive areas such as human mucous membranes and skin.

      2. Multi-functionality, wide application scope: It combines antibacterial, anti-inflammatory, repair, and immune regulation functions. It can achieve "defense + repair" dual effects without the need to combine multiple components.

      3. High purity, easy to prepare: Artificial synthesis can reach a 99% high purity level. The product is in the form of white freeze-dried powder, has good water solubility, and can be used in combination with other peptides and active ingredients.

      4. Safe and residue-free: Different from chemical antibiotics, it can be degraded into amino acids by proteases in the human body and does not cause damage to normal human cells.

    3. Shop LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99%-Detailed Image 1 Shop LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99%-Detailed Image 2 Shop LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99%-Detailed Image 3 Shop LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99%-Detailed Image 4
    4. Shop LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99%-Detailed Image 5 Shop LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99%-Detailed Image 6

    Transport
    Company offers diverse shipping options: air, land, and sea transport. Orders are shipped within one day of placement, with delivery expected within a week. Boasting a high volume of successful transactions, we’ve earned strong trust from clients. Our efficient logistics ensure timely, reliable delivery, making us a dependable partner for your shipping needs.

    Shop LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99%-Detailed Image 7

    Company Profile

    Yinglian Technology Co., Ltd. (Jinzhou Hongbai Technology Co., Ltd. Subsidiary branch company)established in 2015, is a pioneering force in the biotechnology sector. At the core of our operations is the unwavering commitment to our guiding principles: "Quality First, Service Supreme."
    Company Overview:
    Founded in 2015 , our company has been a trailblazer in the field of biotechnology. We pride ourselves on our dedication to delivering cutting-edge products and unparalleled services.
    Business Philosophy:
    "Quality First, Service Supreme" encapsulates our business philosophy. We firmly believe that prioritizing quality in all aspects of our operations and providing exceptional service form the foundation for enduring success.
    Key Products:
    Our primary focus encompasses a range of products, including weight loss peptides, medicinal peptides, cosmetic peptides, and customized peptides. Notable among our weight loss peptide offerings are Semaglutide, Tirzepatide, Retatrutide, and others.
    Mission:
    Our mission is to spearhead advancements in biotechnology by consistently upholding the highest standards of quality and service. Through innovation and excellence, we aim to contribute to the betterment of global health and well-being.
    Customized Peptides:
    In addition to our standard product line, we specialize in crafting customized peptides tailored to meet the unique needs of our diverse clientele.
    Future Vision:
    As we move forward, yinglian technology is poised for continued growth and innovation. We are committed to expanding our product portfolio, staying at the forefront of technological advancements, and exceeding the expectations of our valued clients.
    At Synpeptide Co., Ltd, we are not just shaping the future of biotechnology; we are pioneering a path towards a healthier and more sustainable world.

    Shop LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99%-Detailed Image 8

    Shop LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99%-Detailed Image 9 Shop LL37 Peptide CAS 154947-66-7 Factory Supply High Purity Peptide 99%-Detailed Image 10

    How to proceed your order:
    Step 1:Please let me know the items you are favorable, quantities, and the destination country.
    Step 2:You confirm all detail, and offer purchasing order.
    Step 3:We send the detail price of our product and offer the suitable shipping method for reference.
    Step 4:You confirm the order and payment 100% in advance and send us the detailed contacting information, including contacting person/company,address,mobile number,ZIP code and your special requirements.
    Step5:We arrange the shipment according to your requirements, and tracking code will be offered once it is released, then you can track your parcel at any moment.
    Step 6:We offer after-sales services after service after you receive your parcel.

    Q1: Have your Product Quality been Approved by Third Party Lab?
    Re: Yes, All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China. So you will be assured with Good Quality if you choose us.
    Q2: May I get one sample before placing order?
    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.
    Q3: Which payment is available for your company?
    Re: T/T, PayPal,bank transfer etc. You can choose the one which is convenient for you.
    Q4: How and when can I get my goods after payment?
    Re: For small quantity products, they will be delivered to you by international courier(DHL, FedEx, TNT etc.) or by air. Usually it will cost 5-7days that you can get the goods after delivery.For large quantity products, shipping by see is worthwhile.It will cost 15 to 30 days to come to your destination port, which depends on where the port is.
    Q5: How about the price? Can you make it cheaper?
    Re: We always take the customer's benefit as the top priority. Price is negotiable under different conditions, we are assuring you to get the most competitive price.
    Q6:How to ensure the quality of your products?
    From raw materials, production, processing, packaging, storage to shipment, we have carried out strict quality control .
    Q7: Is there any possible to use my appointed label or package?
    Re: Yes. If needed, we'd like.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    GLP-1,Retatrutide,Selank,Tirzepatide

    Location:

    Room 2012, No. 6-143, Section 2, Shanghai Road, Guta District, Jinzhou City, Liaoning Province

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment

    Average lead Time:

    1

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    5-10

    Year of Establishment:

    2024

    Yinglian Technology Co., Ltd. Jinzhou Hongbai Technology Co., Ltd. Subsidiary branch company.We mainly engage in peptides, synthetic peptide amino acids, beauty and weight - loss products, as well as raw materials for beauty and freckle - removing cosmetics, all of which are of reliable quality. Committed to strict quality control and thoughtful customer service, our experienced staff are always ready to discuss your requirements to ensure customer satisfaction. "Quality first, service foremost" summarizes our business philosophy. We firmly believe that prioritizing quality in all aspects of operations and providing excellent service lay the foundation for long - term success. Our mission is to lead the advancement of biotechnology by consistently adhering to the highest standards of quality and service. We hope to contribute to improving global health through innovation and excellence. We focus on high quality, competitive prices, flexible order quantities and timely delivery. Our products are mainly exported to European countries, the United Kingdom, the United States, Canada and Australia. We have extensive export experience and have never encountered any customs clearance issues. By focusing on sourcing materials of perfect quality and ensuring strict internal process control, our products have been widely recognized and trusted by users.

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.