Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Antioxidant Ingredient > LL-37 for Sale > LL37 with high quality and high sales volume
LL37  with high quality and high sales volume buy - large image1
LL37  with high quality and high sales volume buy - image1
LL37  with high quality and high sales volume buy - image2
LL37  with high quality and high sales volume buy - image3
LL37  with high quality and high sales volume buy - image4
LL37  with high quality and high sales volume buy - image5
LL37  with high quality and high sales volume buy - image6

LL37 with high quality and high sales volume

3 Inquiries

Unit Price:

$40/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Industrial Grade

Content:

99%

Port:

shenzhen

Brand:

peptide

Packaging:

5mg*10vials

Price valid (until):

2026-09-17

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,Semaglutide,GHK-CU

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  



        Importantly, replenishing in has demonstrated anti-aging effects, offering promising results in reversing the progression of age-related diseases and extending both lifespan and healthspan. By boosting NAD+ levels, it is possible to enhance metabolic function, which in turn supports overall health and well-being, making it a potential therapeutic target for the treatment and prevention of age-related conditions.



    Shop The Tirzep atide manufacturer has started shipping, with high quality and high sales volume.-Detailed Image 1
    Items Specifications
    Product Name Tirzepatide
    CAS No  

    2023788-19-2

    Appearance  

    White to off-white

    Shop The Tirzep atide manufacturer has started shipping, with high quality and high sales volume.-Detailed Image 2

    The importance of peptides:


    Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.


    Shop The Tirzep atide manufacturer has started shipping, with high quality and high sales volume.-Detailed Image 3

     

    Storage conditions    


    Should be stored in the refrigerator at 2°C to 8°C, away from light.


    If required, each single-dose pen can be stored unrefrigerated at a temperature not exceeding 30°C for up to 21 days, but once stored at room temperature it should not be returned to the refrigerator. If not used within 21 days after removal from the refrigerator, it should be discarded. Do not freeze tilpotide and if frozen, do not use.


    Shop The Tirzep atide manufacturer has started shipping, with high quality and high sales volume.-Detailed Image 4


    Note:


    1.High quality and competitive price.

    2.Promptly delivery by well-reputed shipping lines.

    3.Trial order is available for testing after samples.

    4.We will inform you all the information at every stage in advance.

    5.Packaging can gear to buyers’ special request.



    Shop The Tirzep atide manufacturer has started shipping, with high quality and high sales volume.-Detailed Image 5


    Benefits: 


    1. Ultra-low temperature freezing: Freeze the highly active ingredients at -196 degrees to put the active ingredients into a dormant state.

    2. Effective regeneration: Add the solvent to the powder when using it, and it can be effectively regenerated after mixing, ensuring the high activity and high stability of the product.

    3. Nutrients penetrate deep into the skin: Nano transdermal absorption technology is used to deliver active energy to the deep layers of the skin.

    We offer various types of peptides, and we can provide excellent quality and preferential prices for peptides.

    The feedback from customers who have ordered our products (peptides) is very good.

    Reliable buyers around the world can contact us for peptide matters.

    We firmly believe that there is no comparable product in terms of performance and cost-effectiveness. If you have any questions about this product or want to know how it can benefit your business, please feel free to contact us at any time. We are committed to providing excellent customer service and helping our customers achieve their business goals. Thank you for considering using Jinbei products. We look forward to having the opportunity to cooperate with you and help you succeed.







    How to handle your order:


    Step 1: Please tell me the products you like, the quantity and the destination country.

    Step 2: You confirm all the details and provide the purchase order.

    Step 3: We will send you the detailed prices of our products and provide suitable transportation methods for your reference. Step 4: Please confirm your order and payment 100% in advance and send us detailed contact information, including the contact person/company, address, mobile phone number, postal code and your special requirements.

    Step 5: We will arrange the shipment according to your requirements. After shipment, we will provide a tracking code, allowing you to track your package at any time.



    Shop The Tirzep atide manufacturer has started shipping, with high quality and high sales volume.-Detailed Image 7

    Why choose us?  

     


    Our Advantages.  

    1.High quality with competitive price.

    2. All purity>99%.  

    3. We are manufacturer and can provide high quality products with factory price.


    Fast and safe delivery.

    1. Parcel can be sent out in 24 hours after payment tracking number available.


    2. Secure and discreet shipment verious transportation methods for your choice.


    3. Customs pass rate >99%.


    We have clients throughout the world.


    1. Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.


    2. Market feedback and goods feedback will be appreciated, meeting customers’ requirement is our principal responsibility.



    3. High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.


    FAQ



    Q1: Have your Product Quality been Approved by Third Party Lab?

    A: Yes, All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China. So you will be assured with Good Quality if you choose us.

    Q2: How to cooperate with us?

    You can contact us for cooperation through the website contact information, or contact with the salesmen in our company. We will connect you about the specific detail via email.

    Q3: Is there any discount?

    A: Yes, for larger quantity, we always support with better price.

    Q4: Do you accept VISA business credit card?

    A: Sorry we don't accept VISA credit card,

    We'd like to accept bitcoin, USDT, bank transfer, paypal etc.

    Q5: How long does it take to the goods arrived?

    A:It is Depending on your location.

    For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, EMS.

    For mass order, please allow 5-8 days by Air, 20-35 days by Sea.

    Q6: May I get one sample before placing order?

    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.

    Q7: Do you have any reshipment policy ?

    We have good after-sale service and re-shipment policy if the parcel lose.

    Our long association with our clients has brought great benefits.

    We always take the upmost care in the packaging of our products .

    Our clients will confirm this as even they struggle to find them without help at times.

    But in spite of our best efforts it is still possible will seize a small number of packages.

    In this circumstance we promise reship free to establish long term relationship.


    Pls input...

    Items Specifications






    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,Semaglutide,GHK-CU

    Location:

    Room 1209, 12th Floor, Unit 1, Building 1, Block A, Shenglong Plaza, No.80 Weiyang Road, Weiyang District, Xi'an City, Shaanxi Province, P.R.China

    Payment Terms:

    TT against copy of documents,D/A,100% TT in advance

    Average lead Time:

    15

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2025

    Xi'an Haoming Technology Co., Ltd. Founded in 2020, we are a professional supplier of high‑quality functional peptides. Our main product range includes weight‑loss peptides, anti‑wrinkle peptides, tanning peptides and other active peptide ingredients, widely used in cosmetics, skincare and health‑care industries. Strict quality‑control standards are applied throughout raw‑material screening, production and shipment to deliver consistent and reliable product quality.

    Putting customer value first, we supply premium‑grade products with competitive pricing, flexible MOQs and on‑time delivery. Our goods are well‑sold across Europe, the UK, the USA, Canada, Australia and other regions, earning wide recognition and trust from global buyers.

    We maintain stable independent international logistics channels covering the USA, Canada, UK, Germany, Spain, Poland, the Netherlands, Russia, Kazakhstan and more. One‑stop door‑to‑door delivery with full customs‑clearance service is available to free customers from cross‑border logistics troubles.

    Upholding the business philosophy of “Survive by Quality, Develop by Reputation”, Xi'an Haoming Technology Co., Ltd. keeps tight control over raw‑material procurement and production procedures. Free samples are offered prior to formal orders. All items are manufactured efficiently under high‑safety standards. Backed by a complete after‑sales system, we deliver prompt replies and professional solutions for satisfying cooperation.

    With consistent integrity, professional technical support and efficient service, we keep providing overseas partners with stable quality, competitive rates and reliable after‑sales support. Xi'an Haoming Technology Co., Ltd. aims to be your trusted long‑term supplier for peptide raw materials.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.