 Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > DSIP| TongPeptides | 99% Purity |COA

DSIP| TongPeptides | 99% Purity |COA buy - large image1

DSIP| TongPeptides | 99% Purity |COA buy - image1

DSIP| TongPeptides | 99% Purity |COA buy - image2

DSIP| TongPeptides | 99% Purity |COA buy - image3

DSIP| TongPeptides | 99% Purity |COA buy - image4

DSIP| TongPeptides | 99% Purity |COA

Name: DSIP| TongPeptides | 99% Purity |COA
Brand: Tongpeptide
SKU: pr2608181116
Price: 4 USD
Availability: InStock

TDS 3 Inquiries

Unit Price: Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.5%

Port:

CHINA

Brand:

Tongpeptide

Packaging:

mg*10vials

Sample Available:

Yes

Price valid (until):

2026-09-18

Contact Supplier

 Chat Now

Tong peptides

Company Type:

Manufactory

Location:

China

Payment Terms:

TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Qualification:

Main Products:

retatrutide,TB-500,GHK-CU,peptide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Descriptiopn

Name:Alice

Whatsapp:+852 5513 4538

Email:alice@tongpeptides.com

Name:Alice

Whatsapp:+852 5513 4538

Email:alice@tongpeptides.com

DSIP is a high-quality synthetic bioactive peptide raw material dedicated to high-end cosmetic formula research and modern skincare product development. Produced via precise solid-phase synthesis technology and multi-stage low-temperature purification and lyophilization processes, this premium ingredient features a highly stable molecular structure, excellent water solubility and superior skin compatibility. With rigorous raw material screening and standardized industrial production procedures, each batch of DSIP maintains high purity and stable biological activity, effectively avoiding formula instability caused by impurity residues. It perfectly adapts to the current market demand for mild, safe and high-efficiency innovative skincare raw materials.

The core advantage of DSIP is its gentle and precise skin microenvironment conditioning performance. Daily skin is constantly affected by irregular metabolic status, environmental dryness and cumulative external stimulation, which easily leads to weakened skin vitality, dull complexion and poor skin tolerance. As a mild regulating active substance, DSIP can effectively soothe cutaneous metabolic pressure, balance the physiological state of skin tissues, and assist the skin in completing daily self-maintenance and self-regulation. Different from fast-acting single-effect ingredients, it adopts a gradual conditioning mechanism to relieve skin fatigue, improve dull and tired skin texture, and restore skin’s natural clarity and delicacy.

In daily skin care and barrier maintenance, DSIP delivers outstanding comprehensive optimization effects. It can cooperate with the skin’s natural circulation system to improve overall skin condition, enhance skin softness and smoothness, and relieve subtle discomfort caused by environmental changes and long-term external erosion. Extremely mild and non-irritating, it is friendly to all skin types, especially sensitive and fragile skin with low tolerance. Its stable activity will not be easily affected by conventional cosmetic matrix environments, bringing lasting and gentle care to skincare formulas.

With excellent formula compatibility, DSIP can be perfectly added into essences, moisturizing lotions, facial creams and various daily high-end maintenance skincare products. It can be flexibly combined with other common cosmetic active ingredients to build multi-dimensional skin conditioning formulas without causing product stratification, discoloration or activity attenuation. Supported by complete quality inspection reports and stable batch output capacity, DSIP has become a reliable and innovative active raw material for major skincare brands.

Shipping Method Shop KPV5KPV10-Detailed Image 3

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 11

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 13

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 14

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 15

Introduction to Our Factory

We are a professional and reliable peptide manufacturing factory in China, focusing on the R&D, production and supply of high-purity research-grade peptides and biochemical raw materials. Adhering to strict production standards and complete quality control systems, we are committed to providing cost-effective, high-quality peptide products and stable global supply services for international customers.

Quality is our core advantage. All our peptide products adopt advanced synthesis and purification technology, with universal HPLC purity over 99%. Every batch of goods undergoes strict laboratory testing, including high-performance liquid chromatography and mass spectrometry analysis. Complete test reports are provided to ensure stable ingredient content, low impurity rate and consistent product quality. All products are lyophilized and sealed in sterile independent vials to guarantee long-term stability during international transportation and storage.

Compared with other suppliers in the industry, we offer obvious price advantages. With independent production bases, standardized assembly lines and integrated supply chain management, we effectively reduce intermediate costs. We provide factory-direct wholesale prices while maintaining top-tier purity and quality, helping customers maximize profit margins with high cost performance.

Sufficient in-stock inventory covers mainstream peptide products, enabling rapid shipment within 1–3 working days after order confirmation. We have long-term cooperative professional freight teams, supporting stable and safe shipping to Europe, America, Southeast Asia, South America and other regions worldwide. With rich international export experience, our professional document sorting and standardized packaging greatly improve customs clearance pass rate, effectively avoiding customs detention risks and ensuring safe and smooth delivery of each order.

We always insist on standardized export procedures, stable quality control, competitive factory prices and efficient after-sales service, aiming to become your most trustworthy long-term peptide supply partner. All products are for laboratory research use only, not for human clinical use.

Q&A

Q1: Why should you buy from us instead of other suppliers?

A1: Because we are a factory, we can provide lower prices and guaranteed quality. We have extensive experience in domestic and foreign trade and provide services in an honest, timely and efficient manner.

Q2: When can I receive the package?

A2: It will be shipped as soon as possible after payment, and the shipping time is generally 7 to 12 days.

Q3: What is the minimum amount I can order?

A3: The minimum quantity we can order is 1 box, which contains 10vials.

Items	Specifications
DS5	*5mg 10vials**
DS10	*10mg 10vials**
DS15	*15mg 10vials**

Shop KPV5KPV10-Detailed Image 20

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Research & Reference Note

DSIP| TongPeptides | 99% Purity |COA is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Authoritative sources

Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Polypeptide

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Manufactory

Main Products:
retatrutide,TB-500,GHK-CU,peptide

Location:
1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

Payment Terms:
TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Total Annual Revenue:
$10 million-$25 million

Total Employees:
501-1000

Year of Establishment:
2023

Pharma Grade Peptides is your premium source for high-quality purified research peptides.

We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

Over the course of many years, we have empowered researchers and scientists to
explore new avenues of scientific discovery.

Inquiry History

3 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Wholesales peptides CAS 154947-66-7 LL37 5mg Peptide with high quatity	Pharmaceutical Grade/99	$65-80/UNIT FOB	Shaanxi TNJONE Pharmaceutical Co., Ltd	Inquiry
Fast Delivery Bodybuilding Weight Loss Peptide Powder Great Quality Wholesale Price LL37	Pharmaceutical Grade/99	$70-90/UNIT FOB	American peptide biotechnology LLC	Inquiry
Peptide White Powder LL-37 99% Purity LL37 Antimicrobial Peptide CAS:154947-66-7	Pharmaceutical Grade/99	$100-130/UNIT FOB		Inquiry
LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sales	Pharmaceutical Grade/99	$80-100/MT FOB	Jinan Zhiwenxinsheng Electric Technology Co., Ltd.	Inquiry
LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality peptide powder The Human Cathelicidin Antimicrobial Peptide	Pharmaceutical Grade/99	$100/UNIT FOB	Enshi Technology Co., Ltd.	Inquiry

DSIP| TongPeptides | 99% Purity |COA

Product Description

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches

More from this Seller