Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality peptide powder The Human Cathelicidin Antimicrobial Peptide
LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality  peptide powder The Human Cathelicidin Antimicrobial Peptide buy - large image1
LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality  peptide powder The Human Cathelicidin Antimicrobial Peptide buy - image1
LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality  peptide powder The Human Cathelicidin Antimicrobial Peptide buy - image2
LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality  peptide powder The Human Cathelicidin Antimicrobial Peptide buy - image3
LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality  peptide powder The Human Cathelicidin Antimicrobial Peptide buy - image4
LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality  peptide powder The Human Cathelicidin Antimicrobial Peptide buy - image5
LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality  peptide powder The Human Cathelicidin Antimicrobial Peptide buy - image6

LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality peptide powder The Human Cathelicidin Antimicrobial Peptide

TDS 1 Inquiries

Unit Price:

$100-110/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GuangZhou

Brand:

EnShi

Packaging:

5mg*10vials

Price valid (until):

2028-01-01

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

       Name :Leona

    Whatsapp/wechat:+852 96816401

    Email:sjzes4@enshikj.com

    What is LL37 ?                                                           

    LL37 (also known as CAP18-derived peptide or human cathelicidin antimicrobial peptide) is the only cathelicidin family antimicrobial peptide (AMP) found in humansPMC. It is a 37-amino acid cationic, amphipathic peptide derived from the precursor protein hCAP18 (human cationic antimicrobial protein 18 kDa).
    Feature Details
    Name Origin Derived from its N-terminal two leucine (L) residues and 37 amino acid length
    Precursor hCAP18 (18 kDa protein), encoded by the CAMP gene on chromosome 3
    Activation Processed from hCAP18 by serine proteases (serine protease 3, kallikrein 5) extracellularly
    Structure Forms an α-helical motif (residues 2-31) with a disordered C-terminal tail in physiological conditionsPMC
    Charge Strongly cationic (rich in lysine and arginine)
    Expression Sites Neutrophils, macrophages, NK cells, epithelial cells (skin, respiratory tract, gastrointestinal tract, urogenital tract, eye surface)PMC

    • Shop Factory direct sales of high-quality Thymalin white powder peptide 10mg Immune regulation tissue repair Best price-Detailed Image 2 Shop LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality  peptide powder The Human Cathelicidin Antimicrobial Peptide-Detailed Image 2
    • Biological Functions:                                                

    • 1、Antimicrobial Activity:
    • Primarily through the "carpet-like" model or "toroidal pore" formation in microbial membranes, causing membrane disruption and cell lysis. Its cationic nature interacts with negatively charged microbial membranes, while hydrophobic residues allow insertion into lipid bilayers.
    • 2、 Immune Modulation (Dual Role): Pro-inflammatory Effects / Anti-inflammatory Effects
      • 3、 Other Key Functions:
        Wound Healing: Promotes re-epithelialization, angiogenesis, and tissue repair
        • Antitumor Activity: Inhibits cancer cell proliferation and migration, induces apoptosis
        • DNA/RNA Interactions: Forms complexes with nucleic acids, stimulating plasmacytoid dendritic cells to produce type I interferons
        • Anti-biofilm: Disrupts established biofilms and prevents new formation
    • Shop Factory Supply LL 37 CAS 154947-66-7 High quality LL-37 peptide powder The Human Cathelicidin Antimicrobial Peptide-Detailed Image 3

      Lyophilization Technology Advantages:                 

    • Our LL37 undergoes state-of-the-art freeze-drying process that delivers unmatched benefits:
      1、Maximum Activity Retention: Preserves LL37's native structure and biological activity by avoiding thermal degradation
      2、 Exceptional Stability: Extends shelf life to 24 months when stored properly (vs. 3-6 months for liquid forms)
      • 3、Enhanced Purity: Removes residual solvents and moisture completely, minimizing degradation factors
      • 4、Easy Reconstitution: Dissolves rapidly in sterile water or saline with no clumping
      • 5、Reduced Contamination Risk: Aseptic manufacturing process ensures product safety

      Shop LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality  peptide powder The Human Cathelicidin Antimicrobial Peptide-Detailed Image 4
    • Clinical Significance:                                                
      • 1、First-line defense against infections (innate immunity)
      • 2、Protection of mucosal surfaces and skin
      • 3、Wound repair and tissue regeneration
      • 4、Potential therapeutic agent for antibiotic-resistant infectionsPMC
    • Shop Factory Supply LL 37 CAS 154947-66-7 High quality LL-37 peptide powder The Human Cathelicidin Antimicrobial Peptide-Detailed Image 5
    • Company Profile:                                                    

    EnShi Technology Co., Ltd is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. With years of experience in the pharmaceutical chemical and biosynthetic industries.It provides compliant, stable and cost-effective core raw materials as well as one-stop CDMO/CMO solutions for global pharmaceutical enterprises and innovative drug R&D institutions.

    Shop Factory Supply LL 37 CAS 154947-66-7 High quality LL-37 peptide powder The Human Cathelicidin Antimicrobial Peptide-Detailed Image 7 Shop LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality  peptide powder The Human Cathelicidin Antimicrobial Peptide-Detailed Image 7 Shop LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality  peptide powder The Human Cathelicidin Antimicrobial Peptide-Detailed Image 8

    Packing:                                                                   

    Shop Factory direct sales of high-quality Thymalin white powder peptide 10mg Immune regulation tissue repair Best price-Detailed Image 9

    Shipping:                                                                

    Shop Factory direct sales of high-quality Thymalin white powder peptide 10mg Immune regulation tissue repair Best price-Detailed Image 10

    FAQ:                                                                        

    1. How to make an order?
    Send me message and let me know what you need with quantity , then i will calculate to you

    2. What's the lead time and shipping ways?
    We will delivery to the package by USPS, FEDEX, DHL paket and YANWEN express to you after receive your payment, it would take around 5-15 days to your address.

    3. How do i keep the peptides when i receive it ?
    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    4. What's the payment methods ?
    We could accept pay through paypal,bank transfer, XTransfer and bitcoin.

    Certificates
    • LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality  peptide powder The Human Cathelicidin Antimicrobial Peptide Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    Room 704#-A010, Building 11, Block 16, Liangzhu Street, Yuhang District, Hangzhou City, Zhejiang Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    3

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2025

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.