Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > High-purity tezepatide 500mg lyophilized powder, developed in the laboratory, shipped from the factory in China.
High-purity tezepatide 500mg lyophilized powder, developed in the laboratory, shipped from the factory in China. buy - large image1
High-purity tezepatide 500mg lyophilized powder, developed in the laboratory, shipped from the factory in China. buy - image1
High-purity tezepatide 500mg lyophilized powder, developed in the laboratory, shipped from the factory in China. buy - image2
High-purity tezepatide 500mg lyophilized powder, developed in the laboratory, shipped from the factory in China. buy - image3
High-purity tezepatide 500mg lyophilized powder, developed in the laboratory, shipped from the factory in China. buy - image4
High-purity tezepatide 500mg lyophilized powder, developed in the laboratory, shipped from the factory in China. buy - image5
High-purity tezepatide 500mg lyophilized powder, developed in the laboratory, shipped from the factory in China. buy - image6

High-purity tezepatide 500mg lyophilized powder, developed in the laboratory, shipped from the factory in China.

TDS 3 Inquiries

Unit Price:

$150/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

China

Brand:

Tong peptide

Packaging:

50mg/1box*10vials

Price valid (until):

2026-08-31

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

retatrutide,TB-500,GHK-CU,peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Name: Iris

    WhatsApp: +852 7094 7882
    Email: iris@tongpeptides.com


    Product Detail  

    Made of premium raw materials with high purity and low impurity. It has stable physical properties and excellent water solubility. Rich in biological activity with mild and efficient effect, consistent batch quality and easy storage. Widely used in biological scientific research and related experiments with stable supply and reliable quality.

    Peptide products offer diverse functional benefits across multiple scenarios:

    in health management, peptides support metabolic regulation (aiding in blood sugar control and healthy weight management for specific groups) and immune system modulation by enhancing the body's defense responses; 

    in skincare, peptides promote skin barrier repair, boost collagen synthesis to reduce fine lines, and improve skin hydration and elasticity; 

    in sports nutrition, peptides assist in muscle recovery by reducing post-exercise tissue damage and supporting muscle protein synthesis.

    Shop Cosmetic ingredient XT100 botulinum toxin anti-wrinkle peptide, shipped from a Chinese factory.-Detailed Image 1
    Shop Cosmetic ingredient XT100 botulinum toxin anti-wrinkle peptide, shipped from a Chinese factory.-Detailed Image 2
    Shop Cosmetic ingredient XT100 botulinum toxin anti-wrinkle peptide, shipped from a Chinese factory.-Detailed Image 3
    Shop Cosmetic ingredient XT100 botulinum toxin anti-wrinkle peptide, shipped from a Chinese factory.-Detailed Image 4
    Shop Cosmetic ingredient XT100 botulinum toxin anti-wrinkle peptide, shipped from a Chinese factory.-Detailed Image 5
    Shop Cosmetic ingredient XT100 botulinum toxin anti-wrinkle peptide, shipped from a Chinese factory.-Detailed Image 6
    Shop Cosmetic ingredient XT100 botulinum toxin anti-wrinkle peptide, shipped from a Chinese factory.-Detailed Image 7

    Shop Cosmetic ingredient XT100 botulinum toxin anti-wrinkle peptide, shipped from a Chinese factory.-Detailed Image 8 Shop Cosmetic ingredient XT100 botulinum toxin anti-wrinkle peptide, shipped from a Chinese factory.-Detailed Image 9 Shop Cosmetic ingredient XT100 botulinum toxin anti-wrinkle peptide, shipped from a Chinese factory.-Detailed Image 10

    Why Choose Us

    Strict‑Standard Quality Inspection

    Each batch comes with complete test files, including HPLC‑based purity reports and mass‑spectrometry identification in the Certificate of Analysis (CoA). Typical purity exceeds 98%. We guarantee stable product identification, high purity and consistent quality across batches.

    Lab‑Oriented Raw‑Material Supplier

    Our biochemical raw materials cater to research‑and‑development labs, pre‑clinical trials, and commercial production in the biotechnology, skincare and nutritional‑supplement sectors.

    Stable Worldwide Logistics Service

    Cooperating with trusted logistics providers, we provide safe, confidential and temperature‑controlled international delivery, making sure goods arrive safely and on schedule.

    Flexible Service for Different‑Order Demands

    We support small lab‑use samples as well as large‑scale bulk purchases. Qualified clients can access customized purity adjustment, ingredient mixing and private‑label packaging services.

    FAQ

    Q1. How do you ensure product quality?
    A: We have a strict quality management system, all batches must be tested and meet our standards before entering the warehouse. The purity of all our products is above 99.00%, which has been verified by many American and European customers.
     
     
    Q2. How to place an order with you?
    A: Once we confirm the required dosage/strength and quantity of the product with the customer, and the customer confirms and makes payment, we will arrange shipment as soon as possible.
     
     
    Q3. What payment methods are there?
    A: There are Bank Transfer, Tether USD(USDT) and Bitcoin(BTC).
     
     
    Q4. What shipping methods can we choose?
    A: Usually express delivery is more suitable, including DHL, FedEx, UPS, etc. We will be responsible for customs clearance in the destination country, and customers are not required to cooperate with customs clearance and pay any tariffs.

    Fast and safe delivery.

    1)Parcel can be sent out in 24 hours after payment tracking number available.

    2)Secure and discreet shipment verious transportation methods for your choice.

    3)Customs pass rate >99%.

    We have clients throughout the world.

    1)Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.

    2)Market feedback and goods feedback will be appreciated, meeting customers' requirement is our principal responsibility.

    3)High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.


    How to proceed your order:

    Step 1:Please let me know the items you are favorable, quantities, and the destination country.

    Step 2:You confirm all detail, and offer purchasing order.

    Step 3:We send the detail price of our product and offer the suitable shipping method for reference.

    Step 4:You confirm the order and payment 100% in advance and send us the detailed contacting information, including contacting person/company,address,mobile number,ZIP code and your special requirements.

    Step5:We arrange the shipment according to your requirements, and tracking code will be offered once it is released, then you can track your parcel at any moment.

    Step 6:We offer after-sales services after service after you receive your parcel

    Shop High-purity tezappetide lyophilized powder for laboratory research, shipped from our factory in China.-Detailed Image 11 Shop High-purity tezappetide lyophilized powder for laboratory research, shipped from our factory in China.-Detailed Image 12 Shop High-purity tezappetide lyophilized powder for laboratory research, shipped from our factory in China.-Detailed Image 13 Shop High-purity tezappetide lyophilized powder for laboratory research, shipped from our factory in China.-Detailed Image 14 Pls input...

    If you would like to know more about product quality, purity data, dosage guidance and professional product efficacy information, feel free to get in touch with us. We are a Chinese integrated factory combining production and trade, and we can offer you competitive factory‑direct prices.

    Reach me via WhatsApp: +852 7094 7882

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    High-purity tezepatide 500mg lyophilized powder, developed in the laboratory, shipped from the factory in China. is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    retatrutide,TB-500,GHK-CU,peptide

    Location:

    1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    501-1000

    Year of Establishment:

    2023

    Pharma Grade Peptides is your premium source for high-quality purified research peptides.

    We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

    Over the course of many years, we have empowered researchers and scientists to
    explore new avenues of scientific discovery.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.