Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Thymalin Peptide Raw Material for Laboratory Research and Analytical Testing
Thymalin Peptide Raw Material for Laboratory Research and Analytical Testing buy - large image1
Thymalin Peptide Raw Material for Laboratory Research and Analytical Testing buy - image1
Thymalin Peptide Raw Material for Laboratory Research and Analytical Testing buy - image2
Thymalin Peptide Raw Material for Laboratory Research and Analytical Testing buy - image3
Thymalin Peptide Raw Material for Laboratory Research and Analytical Testing buy - image4
Thymalin Peptide Raw Material for Laboratory Research and Analytical Testing buy - image5
Thymalin Peptide Raw Material for Laboratory Research and Analytical Testing buy - image6

Thymalin Peptide Raw Material for Laboratory Research and Analytical Testing

TDS 3 Inquiries

Unit Price:

$60/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Research Grade

Content:

99%

Port:

深圳

Brand:

XH

Packaging:

10mg/vial10vial/kit

Price valid (until):

2026-10-03

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Contact Information   


    Sales Manager Name: Airs
    WhatsApp Number: +852 5531 1275
    Email Address: meslane07@163.com

    Thymalin Peptide Powder – Professional Research Material with Wholesale Supply

    Thymalin is a peptide-based material supplied in powder form for laboratory research, analytical testing, scientific evaluation, and related non-clinical research applications. We provide this product to professional customers with an emphasis on consistent specifications, quality control, secure packaging, and dependable supply.

    The product is processed and packaged under controlled production conditions. Our quality management procedures cover raw material handling, production processes, finished product inspection, packaging, labeling, and batch management.

    Product Information

    Thymalin
    Peptide Research Material
    Powder Form
    High Purity Specification
    Professional Packaging
    Wholesale and Bulk Supply Available

    The product is suitable for professional research customers who require peptide materials with clearly defined specifications. Customers can contact us for available specifications and supporting product documentation.

    Quality and Consistency

    Maintaining consistent quality is one of our primary objectives. We use controlled production and packaging procedures to help reduce variation between batches. Product information can be reviewed before order confirmation, allowing customers to select the appropriate specification according to their purchasing requirements.

    Relevant quality documents may be available upon request, depending on the product specification and order requirements.

    Packaging

    Thymalin can be supplied in professional packaging suitable for laboratory material handling and international transportation. Standard packaging options are available, while customized packaging requirements can be discussed for larger orders.

    For wholesale customers, we can also discuss customized labels, outer packaging, order quantities, and other purchasing requirements.

    Storage and Handling

    The product should be stored according to the recommended conditions provided with the applicable product documentation. Keep the container properly sealed and protect the product from unsuitable environmental conditions during storage and transportation.

    Wholesale Service

    We welcome inquiries from distributors, laboratories, research organizations, trading companies, and other qualified B2B customers. Our supply service can cover product consultation, quotation, packaging confirmation, documentation, order processing, and international shipment coordination.

    Whether you are looking for a trial quantity or a larger wholesale order, our team can provide a suitable quotation based on your required specification and quantity.

    Please contact us for the latest price, available packaging sizes, product specifications, quality documentation, and shipping information.


    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 2
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 3
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 4
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 5
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 6
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 7


    Product Detail  You might be interested in these


    1. Can we get free samples?
    We can provide free samples for testing, but the buyer is responsible for the shipping costs.
    2. Can we print designs or apply labels to the bottles?
    We offer various printing methods, such as screen printing, hot stamping, and label printing.
    3. What is the standard lead time?
    In-stock items will be shipped within 24–48 hours of receiving payment.
    Custom-colored bottles will be shipped within 3–5 days.
    4. What are your shipping terms?
    We offer sea and air shipping, as well as courier services such as FedEx, DHL, UPS, and TNT.
    5. How does your factory handle quality control?
    We conduct three rounds of testing before packaging. If any quality issues—such as breakage—arise after delivery, we will handle the after-sales service.


    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 8
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 9
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 10
    Shop 5-Amino-1MQ 10mg High Purity Powder Chemical Ingredient for Laboratory Research Use-Detailed Image 11

    Pls input...

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    Thymalin Peptide Raw Material for Laboratory Research and Analytical Testing is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides

    Location:

    Y17, Room 310, East Third Floor, No. 64 and 66 Jianzhong Road, Tianhe District, Guangzhou City

    Payment Terms:

    TT against copy of documents,100% TT in advance

    Average lead Time:

    1

    Total Employees:

    11-50

    Year of Establishment:

    2026

    Founded in 2024, PGpeptides is a specialized supplier of high-purity
    research peptides serving the global scientific community. With deep
    industry expertise, we deliver consistent product quality, competitive
    pricing, and flexible service tailored to research institutions, laboratories,
    and distributors worldwide.
    Our operations span North America, Europe, Asia, Australia, and the
    Middle East, backed by a mature international trade infrastructure and a
    reliable global fulfillment network. We have earned strong recognition 
    and trust across the markets we serve.
  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.