Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 99% freeze dried powderLyophilized Powder 154947-66-7 peptides for sale
LL37 99% freeze dried powderLyophilized Powder 154947-66-7 peptides for sale buy - large image1
LL37 99% freeze dried powderLyophilized Powder 154947-66-7 peptides for sale buy - image1
LL37 99% freeze dried powderLyophilized Powder 154947-66-7 peptides for sale buy - image2
LL37 99% freeze dried powderLyophilized Powder 154947-66-7 peptides for sale buy - image3
LL37 99% freeze dried powderLyophilized Powder 154947-66-7 peptides for sale buy - image4
LL37 99% freeze dried powderLyophilized Powder 154947-66-7 peptides for sale buy - image5
LL37 99% freeze dried powderLyophilized Powder 154947-66-7 peptides for sale buy - image6

LL37 99% freeze dried powderLyophilized Powder 154947-66-7 peptides for sale

TDS

Unit Price:

$12-15/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

RL

Packaging:

0.05kg/box

Price valid (until):

2026-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide,retatrutide,Semaglutide

  • Product Description

  • Seller Information

  • Description


      Product Detail  


     

    Top Quality Peptides Lyophilized Powder Retatrutide Fitness and Weight Loss Peptide

    iris01henanrunlian@gmail.com

    Product Description

    Molecular Formula: C221H342N46O68

    Molecular Weight: 4731.33

    Sequence: H-Tyr-Aib-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-α-Me-Leu-Leu-Asp-Lys-{diacid-C20-gamma-Glu-(AEEA)-Lys}-Ala-Gln-Aib-Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

    Appearance: White Powder

    Purity (HPLC): ≥99.0%

    Single Impurity (HPLC): ≤1.0%

    Sodium Content (HPLC): 5.0%-12.0%

    Moisture Content (Karl Fischer): ≤10.0%

    Peptide Content: ≥80.0%

    Storage: Store at 2-8 degrees Celsius in a dry and cool place.

    Packaging: 1g-1kg, plastic bottle

    Intended Use: For scientific research purposes

     

    Shop Glutathione High Quality Research Chemical Peptide Cas Number 70-18-8 Lyophilized Powder-Detailed Image 1 Shop Glutathione High Quality Research Chemical Peptide Cas Number 70-18-8 Lyophilized Powder-Detailed Image 2

    Shop Glutathione High Quality Research Chemical Peptide Cas Number 70-18-8 Lyophilized Powder-Detailed Image 3 Shop Glutathione High Quality Research Chemical Peptide Cas Number 70-18-8 Lyophilized Powder-Detailed Image 4 Shop Glutathione High Quality Research Chemical Peptide Cas Number 70-18-8 Lyophilized Powder-Detailed Image 5 Shop Glutathione High Quality Research Chemical Peptide Cas Number 70-18-8 Lyophilized Powder-Detailed Image 6

    Shop 5 mg 10mg 20mg Vial Peptides in Stock Lyophilized Powder DDP-Detailed Image 2 Shop 10mg 20mg Vial Peptides in Stock Lyophilized Powder DDP-Detailed Image 3.

    Items Specifications
    Product Name Retatrutide
    CAS No. 2381089-83-2
    Purity >99.0%
    Molecular Formula
    C187H291N45O5
    Appearance White Lyophilized powder
    Application Weight loss
    Storage Cool Dry Place
    MOQ 1 box
    Storage After reconstitution store at 2°C - 8°C, well-closed containers
    Package 10 vials per box
    Delivery time Within 3 Working Days Payment

    Function

    1. 1.Treatment of depression and anxiety disorders: Retatrutide has been shown to have antidepressant and anxiolytic effects in preclinical studies, suggesting that it could be a promising treatment option for individuals with these conditions.
    2. 2.Prevention of neurodegenerative diseases: Retatrutide has neuroprotective properties that may be useful in preventing or slowing the progression of neurodegenerative diseases such as Alzheimer's and Parkinson's.
    3. 3.Enhancement of cognitive function: Retatrutide has been shown to improve learning and memory in animal studies, suggesting that it could have potential as a cognitive enhancer in humans.
    4. 4.Treatment of chronic pain: Retatrutide has been shown to have analgesic effects in preclinical studies, suggesting that it could be a useful treatment option for individuals with chronic pain conditions.
    5. 5.Promotion of wound healing: Retatrutide has been shown to accelerate wound healing in animal studies, suggesting that it could have potential as a therapeutic agent for promoting wound healing in humans.

    Shop 10mg 20mg Vial Peptides in Stock Lyophilized Powder DDP-Detailed Image 4 Shop 10mg 20mg Vial Peptides in Stock Lyophilized Powder DDP-Detailed Image 5 Shop 10mg 20mg Vial Peptides in Stock Lyophilized Powder DDP-Detailed Image 6put...


    Why choose us


    1. 1. Higher quality products (>=9  9  % purity) for most of peptides and raws. 


    2. Domestic warehouses and stocks: USA, Canada, Europe and Australia.

    3. Ship worldwide with safe and secure lines: 100% delivery guaranteed. No worry about Customs issues.

    4. Special Service: Drop-shipping if need.

    5. Cheapest prices in the market, unbeatable!

    6. Very reputable:In the most famous boards such as Meso Rx forum and Professional muscle forums,with tons of positive reviews and blind lab tests done by our customers.

    7. Many payment options: Credit card, bank transfer, wise, alipay , apple pay, google pay, wechat, bitcoin, USDT, USDC, To get a full catalog and price list .

    7.If you have any other questions to consult me.please not hesitate to contact me any times.


    Quality and Service


    1.Customer Satisfaction is our priority and guarantee for the future.

    2.We co-develop products and projects with our partners.

    3.Place of Origin China with Super quality by reasonable price.

    4.When you meet problems in mineral processing, we can provide technical guidance.

    5.We will ship the goods that you order from us by EMS, DHL, UPS, or FedEx.We will decided to choose which courier depend on Different countries.To find the best way to delivery the goods for

     you.

    6.We will ship the goods within 5days after get your payments.If you want to cancel or change order, please tell me within 24hours after you finish the payment...So we both can make the best of the bad bargain. Bulk Order: Shipped via sea or air, it's according to your requirement, delivery time is 7-15days after payment

    7.If you have any other questions to consult me.please not hesitate to contact me any times.

    Certificates
    • LL37 99% freeze dried powderLyophilized Powder 154947-66-7 peptides for sale Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide,retatrutide,Semaglutide

    Location:

    Room 2008, 20th Floor, Unit 2, Building 15, No. 152, Dongsanmalu, Guancheng Hui District, Zhengzhou City, Henan Province

    Average lead Time:

    15

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    11-50

    Year of Establishment:

    2024


      Company Profile  


    About Us
    We have been a professional peptide product manufacturer and have overseas warehouses in the United States, Canada and Australia, which are shipped on the same day. Our products are exported to the United States, Canada, Mexico, Australia, the Netherlands, Germany, and other countries. Equipped with state-of-the-art laboratory facilities and cutting-edge production technologies, we uphold the principle of "Quality Primacy" and the philosophy of "Customer Sovereignty" in developing superior biological solutions.

    OEM/ODM Services Available
    Our core competitiveness is rooted in a production system certified by both GMP and ISO. We ensure that our products meet international standards through full-process quality control management. Moreover, by relying on our scientific research and development system, we achieve optimal efficiency in production output. In response to the demands of brand customers, we have specially developed tailored production solutions. Through the OEM/ODM service model, we provide personalized product development plans for our brand enterprises.

    Service Assurance Protocol
    We pledge to ensure the secure transit of client consignments with guaranteed delivery precision. Should any shipment discrepancy occur, our comprehensive compensation policy ensures 100% value reimbursement, coupled with expedited replacement arrangements within 8 business hours.

    Win-win Cooperation
    We cordially invite global partners to witness firsthand how biotechnology is revolutionizing the beauty and wellness industries. At RUNLIAN, every molecular formula embodies the ingenuity of intelligent manufacturing, and every collaboration initiates a new chapter of mutual success. As our founder emphasizes, "We bridge dreams with reality through science, demonstrating China's biotechnological prowess to the world."

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.