Product
Supplier
Encyclopedia
Inquiry
LL37/375 buy - large image1
LL37/375 buy - image1
LL37/375 buy - image2
LL37/375 buy - image3
LL37/375 buy - image4
LL37/375 buy - image5
LL37/375 buy - image6

LL37/375

TDS 3 Inquiries

Unit Price:

$100/KG FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.6%

Port:

HK

Packaging:

5mg*10vials

Price valid (until):

2026-10-04

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Semaglutide,Tirzepatide,Retatrutide,cararilin,semax,liraglutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    ContactInformation WhatsApp+ 85266382632

    Email address zhongjianhuang896@gmail.com


    1.:We offer various types of peptides about the peptides we can provide the good quality the good price.

    Customers who have ordered our products peptides have had very good feedback.

    World wide relaible buyers can contact us about the peptides.


    2:Company advantages


    Are you from these countries?United States, Canada, Spain, Portugal, Australia, Brazil, France, Netherlands, United Kingdom, Bulgaria, Norway, and more.

    Good News! We guarantee smooth customs clearance in key destinations, including Germany and Finland, with no issues at all. Your packages will be securely delivered within 5-15 days.


    Why Choose Us:

    Fast Delivery: We ship your order quickly using DHL, FedEx, and other options. Most orders arrive in 5-15 days.

    Customs Clearance: No customs problems! We make sure your order is delivered smoothly.

    Easy Payment: Pay with Bitcoin,USDT,PAYAPL, or bank transfer.

    Good Quality: Our products are great, and we support small test orders.


    3:Company Introduction

     Yiwu Xingxuan Biotechnology Co. Ltd is a professional manufacturer of various peptide products and chemical raw materials.

    We have a dedicated R&D team and a reliable, efficient logistics team to ensure you receive high-quality products safely and promptly.In order to serve customers well, the company has established special technical department and after-sale service department. Our customers come from countries including the United States, Europe,

    Europe, Japan, South Korea, and India. Most of our main products are in stock and ready for immediate shipment.  Please let us know the specific quantity you need.

    We will make careful reply if you get any question. We will satisfy market demands by top products and better service, and will welcome market challenge .We will offer you the most competitive price. Feel free to contact us for more information.


    4:FAQ


    Q1:Are you a supplier or a manufacturer?

    A:We are both a supplier and a manufacturer.


    Q2:How will you deliver the goods?

    A:We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS, China Air Post. For container products, we can do sea shipping. You also can choose your own shipping forwarder.


    Q3:Which kind of payment terms do you accept?

    A:, Bitcoin, PayPal.USDT.


    Q4:How is the after-sales service?

    A:We will provide high-quality products and ensure 100% safe deliver.


    Q5:how can we guarantee quality?

    A:We will send you a COA (Certificate of Analysis) to you first for you to confirm the quality.


    Q6: How to confirm the Product Quality before placing orders?

    A:You can get free samples for some products, you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.


    Q7:Is there any discount?

    A:Yes, for larger quantity, we always support with better price

    Shop LL37/375-Detailed Image 1
    Shop LL37/375-Detailed Image 2
    Shop LL37/375-Detailed Image 3
    Shop LL37/375-Detailed Image 4
    Shop LL37/375-Detailed Image 5
    Shop LL37/375-Detailed Image 6
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates
    • LL37/375 Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Semaglutide,Tirzepatide,Retatrutide,cararilin,semax,liraglutide

    Location:

    Room 205, Unit 1, Building 165, Taisui Hall, Dayuan Village, Jiangdong Street, Yiwu City, Jinhua City, Zhejiang Province

    Payment Terms:

    TT against copy of documents,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    5

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    51-100

    Year of Establishment:

    2026

    Yiwu Xingxuan Biotechnology Co., Ltd(You-Peptide) is a premium peptide company focused on metabolic health. We are committed to developing prescription-grade peptide products, precisely formulating nutritional supplements, and providing one-on-one lifestyle guidance to help your body work in harmony with you, rather than against you.Yiwu Xingxuan Biotechnology Co., Ltd (You-Peptide) was founded by Dr. Elena Zhou and has its own R&D center, cGMP-compliant cleanrooms, and a complete production line where stainless steel reactors seamlessly connect with AI-powered freeze dryers. From sequence design to final 

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.