Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Gel Forming > LL-37 for Sale > with convenient transportation SM5 CU50+TB10+BC10+KPV10 GT600(Brand) LC600 RT60 CU50 MT-2(Melano 2Acetate) 50AM CJC-12 NO DAC 5mg + IPA5mg
with convenient transportation  SM5  CU50+TB10+BC10+KPV10  GT600(Brand)  LC600  RT60  CU50  MT-2(Melano 2Acetate)  50AM  CJC-12 NO DAC 5mg + IPA5mg buy - large image1
with convenient transportation  SM5  CU50+TB10+BC10+KPV10  GT600(Brand)  LC600  RT60  CU50  MT-2(Melano 2Acetate)  50AM  CJC-12 NO DAC 5mg + IPA5mg buy - image1
with convenient transportation  SM5  CU50+TB10+BC10+KPV10  GT600(Brand)  LC600  RT60  CU50  MT-2(Melano 2Acetate)  50AM  CJC-12 NO DAC 5mg + IPA5mg buy - image2
with convenient transportation  SM5  CU50+TB10+BC10+KPV10  GT600(Brand)  LC600  RT60  CU50  MT-2(Melano 2Acetate)  50AM  CJC-12 NO DAC 5mg + IPA5mg buy - image3
with convenient transportation  SM5  CU50+TB10+BC10+KPV10  GT600(Brand)  LC600  RT60  CU50  MT-2(Melano 2Acetate)  50AM  CJC-12 NO DAC 5mg + IPA5mg buy - image4
with convenient transportation  SM5  CU50+TB10+BC10+KPV10  GT600(Brand)  LC600  RT60  CU50  MT-2(Melano 2Acetate)  50AM  CJC-12 NO DAC 5mg + IPA5mg buy - image5
with convenient transportation  SM5  CU50+TB10+BC10+KPV10  GT600(Brand)  LC600  RT60  CU50  MT-2(Melano 2Acetate)  50AM  CJC-12 NO DAC 5mg + IPA5mg buy - image6

with convenient transportation SM5 CU50+TB10+BC10+KPV10 GT600(Brand) LC600 RT60 CU50 MT-2(Melano 2Acetate) 50AM CJC-12 NO DAC 5mg + IPA5mg

TDS 3 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Cosmetics Grade

Content:

99%

Port:

SHENZHEN

Brand:

sc

Packaging:

5 mg /10 mg / 15 mg / 20 mg / 30 mg / 10 tubes per box

Price valid (until):

2027-01-29

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Business Manager: Summer
    WhatsApp: +852 6469 7344

     Items Specifications
     Appearance  White or off-white powder
    Solubility Clear and colorless
     Purity  >99%

          Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

          The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.Shop Fast shipping   BC5  SM15  TA5  G610  DS5  LC526  CBL60  SK5  2S10-Detailed Image 1





                                                    Why Choose Us
    •High quality products: We have rich experience in production and processing, strict quality inspection.

    •Reasonable prices: Factory direct, reasonable price and negotiable.

    •Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications

    •Quick response: We will reply to your message within 24 hours.

    •Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.




    Shop Fast shipping   BC5  SM15  TA5  G610  DS5  LC526  CBL60  SK5  2S10-Detailed Image 2 Shop Fast shipping   BC5  SM15  TA5  G610  DS5  LC526  CBL60  SK5  2S10-Detailed Image 3


                                                                FAQ

    1. 1.  Q:What is your production cycle and delivery schedule?

    A:For regular products, the delivery cycle is usually 7 to 15 days. We also have buffer stocks of key materials to ensure a stable and continuous supply.

    2. Q: What are your main export markets?

    A:Our products are sold all over the world, including the United States, Canada, Australia, the Netherlands, New Zealand, Italy, France, Germany, Mexico and many other countries and regions.

    3. Q: How do you handle the after-sales service and quality issues?

    A:In case of any issues related to quality, transportation or documentation, our team will promptly communicate and provide effective solutions to safeguard the interests of our customers.

    4. Q: How is the quality of the product?

    A: Before each batch of our products is put on the market for sale, they will undergo corresponding quality inspections to ensure that the purity is above 99% and there will be corresponding test reports for reference.



    Shop Fast shipping   BC5  SM15  TA5  G610  DS5  LC526  CBL60  SK5  2S10-Detailed Image 4

                                     Our advantages

    1. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    4. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.

    5. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.



    Shop Fast shipping   BC5  SM15  TA5  G610  DS5  LC526  CBL60  SK5  2S10-Detailed Image 5

    The importance of peptides:

    •        Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.



           We are a professional peptide supplier, offering four key advantages: high-purity products, efficient and safe global logistics, flexible and convenient payment methods, and a professional and dedicated team - all of which are designed to help your business reach a higher level.
    We collaborate with numerous leading logistics companies worldwide.



           Shuang cheng Trading Co., Ltd. is dedicated to the production and sales of intermediates and peptides, as well as the research and development of new materials such as bodybuilding and shaping, interesting compounds, weight loss, anti-aging, digestive tract disease regulation, and immunity enhancement. We provide professional services including raw materials, resources, and customized production. We are particularly proud of our partnerships in high-quality ingredient and raw material production to meet the needs of our diverse customers.



    We have clients throughout the world.
    1. Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.
    2. Market feedback and goods feedback will be appreciated, meeting customers’ requirement is our principal responsibility.
    3. High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.

    Our global transportation network guarantees that our safe and efficient logistics services can meet your urgent needs.




    Shop Fast shipping   BC5  SM15  TA5  G610  DS5  LC526  CBL60  SK5  2S10-Detailed Image 6 Shop Fast shipping   BC5  SM15  TA5  G610  DS5  LC526  CBL60  SK5  2S10-Detailed Image 7 Shop Fast shipping   BC5  SM15  TA5  G610  DS5  LC526  CBL60  SK5  2S10-Detailed Image 8 Shop Fast shipping   BC5  SM15  TA5  G610  DS5  LC526  CBL60  SK5  2S10-Detailed Image 9 Shop Fast shipping   BC5  SM15  TA5  G610  DS5  LC526  CBL60  SK5  2S10-Detailed Image 10 Shop Fast shipping   BC5  SM15  TA5  G610  DS5  LC526  CBL60  SK5  2S10-Detailed Image 11
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates
    • with convenient transportation  SM5  CU50+TB10+BC10+KPV10  GT600(Brand)  LC600  RT60  CU50  MT-2(Melano 2Acetate)  50AM  CJC-12 NO DAC 5mg + IPA5mg Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Gel Forming

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    20 years of production experience in peptide products

    Safe and unobstructed shipping channels|High quality guaranteed|

    Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.


  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.