 Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > MT1 | TongPeptides |COA 99.9 % Purity |

MT1 | TongPeptides |COA 99.9 % Purity | buy - large image1

MT1 | TongPeptides |COA 99.9 % Purity | buy - image1

MT1 | TongPeptides |COA 99.9 % Purity | buy - image2

MT1 | TongPeptides |COA 99.9 % Purity | buy - image3

MT1 | TongPeptides |COA 99.9 % Purity | buy - image4

MT1 | TongPeptides |COA 99.9 % Purity |

Name: MT1 | TongPeptides |COA 99.9 % Purity |
Brand: Tongpeptide
SKU: pr2609152202
Price: 3 USD
Availability: InStock

TDS 3 Inquiries

Unit Price:

$3/UNIT FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.5%

Port:

CHINA

Brand:

Tongpeptide

Packaging:

mg*10vials

Price valid (until):

2026-10-15

Contact Supplier

 Chat Now

Tong peptides

Company Type:

Manufactory

Location:

China

Payment Terms:

TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Qualification:

Main Products:

retatrutide,TB-500,GHK-CU,peptide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Descriptiopn

Name:Alice

Whatsapp:+852 5513 4538

Email:alice@tongpeptides.com

Name:Alice

Whatsapp:+852 5513 4538

Email:alice@tongpeptides.com

MT1 is a high-grade synthetic peptide reagent designed for modern life science investigations and pre-clinical biochemical mechanism research. Produced through mature solid-phase synthesis techniques and precise multi-stage purification workflows, this peptide exhibits a stable molecular structure, consistent biological activity and excellent water solubility. Thanks to its unique biochemical regulatory characteristics, MT1 has become a trusted experimental material for global laboratories focusing on endogenous signal modulation, cellular functional activity and physiological microenvironment balance analysis.

Distinct from traditional synthetic peptide reagents, MT1 acts on specific biological pathways that support physiological homeostasis and stable cellular metabolism within living organisms. It effectively simulates naturally occurring active biomolecules, assisting in steady intracellular signal transduction and the adjustment of biochemical microenvironment states. Multiple in vitro laboratory evaluations have verified that MT1 delivers mild, safe and highly consistent regulatory performance with superior biocompatibility and minimal experimental deviation. It serves as a robust research tool for exploring biochemical pathway mechanisms, maintaining regular cellular functions and analyzing active substance interactions, supporting a wide range of academic and pre-clinical research projects.

Our MT1 raw materials are manufactured in standardized dust-free production environments under comprehensive quality control protocols. Supplied in lyophilized white powder form, the product achieves a purity of no less than 99.5%, fully validated by professional HPLC and MS testing methods. Every production batch is accompanied by complete COA certification documents, detailed impurity analysis reports and standardized quality inspection records. Rigorous production and testing standards significantly reduce batch-to-batch variations, ensuring stable product performance and reliable experimental repeatability for high-precision scientific research applications.

To preserve its complete biological activity, MT1 requires sealed storage and standardized low-temperature cold-chain transportation. In accordance with global industry regulations, this reagent is intended solely for scientific laboratory research and academic study. It is not authorized for human or animal in vivo usage, clinical diagnosis and treatment, nor for food, pharmaceutical and cosmetic manufacturing processes. We provide flexible specification customization, long-term stable bulk supply and efficient global logistics services, alongside professional technical guidance and full-cycle after-sales support to meet the diverse research needs of global enterprises and scientific research institutions.

Shipping Method Shop KPV5KPV10-Detailed Image 3

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 11

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 13

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 14

Shop Samaglutide2mg,5mg,10mg,15mg,20mg,30mg-Detailed Image 15

Introduction to Our Factory

We are a professional and reliable peptide manufacturing factory in China, focusing on the R&D, production and supply of high-purity research-grade peptides and biochemical raw materials. Adhering to strict production standards and complete quality control systems, we are committed to providing cost-effective, high-quality peptide products and stable global supply services for international customers.

Quality is our core advantage. All our peptide products adopt advanced synthesis and purification technology, with universal HPLC purity over 99%. Every batch of goods undergoes strict laboratory testing, including high-performance liquid chromatography and mass spectrometry analysis. Complete test reports are provided to ensure stable ingredient content, low impurity rate and consistent product quality. All products are lyophilized and sealed in sterile independent vials to guarantee long-term stability during international transportation and storage.

Compared with other suppliers in the industry, we offer obvious price advantages. With independent production bases, standardized assembly lines and integrated supply chain management, we effectively reduce intermediate costs. We provide factory-direct wholesale prices while maintaining top-tier purity and quality, helping customers maximize profit margins with high cost performance.

Sufficient in-stock inventory covers mainstream peptide products, enabling rapid shipment within 1–3 working days after order confirmation. We have long-term cooperative professional freight teams, supporting stable and safe shipping to Europe, America, Southeast Asia, South America and other regions worldwide. With rich international export experience, our professional document sorting and standardized packaging greatly improve customs clearance pass rate, effectively avoiding customs detention risks and ensuring safe and smooth delivery of each order.

We always insist on standardized export procedures, stable quality control, competitive factory prices and efficient after-sales service, aiming to become your most trustworthy long-term peptide supply partner. All products are for laboratory research use only, not for human clinical use.

Q&A

Q1: Why should you buy from us instead of other suppliers?

A1: Because we are a factory, we can provide lower prices and guaranteed quality. We have extensive experience in domestic and foreign trade and provide services in an honest, timely and efficient manner.

Q2: When can I receive the package?

A2: It will be shipped as soon as possible after payment, and the shipping time is generally 7 to 12 days.

Q3: What is the minimum amount I can order?

A3: The minimum quantity we can order is 1 box, which contains 10vials.

Items	Specifications
MT1	*10mg10vials**

Shop KPV5KPV10-Detailed Image 20

Classification of the substance or mixture

Reproductive toxicity, Category 2

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Warning
Hazard statement(s)	H361 Suspected of damaging fertility or the unborn child
Prevention	P203 Obtain, read and follow all safety instructions before use. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
Response	P318 IF exposed or concerned, get medical advice.
Storage	P405 Store locked up.
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Research & Reference Note

MT1 | TongPeptides |COA 99.9 % Purity | is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Authoritative sources

Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Polypeptide

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Manufactory

Main Products:
retatrutide,TB-500,GHK-CU,peptide

Location:
1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

Payment Terms:
TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Total Annual Revenue:
$10 million-$25 million

Total Employees:
501-1000

Year of Establishment:
2023

Pharma Grade Peptides is your premium source for high-quality purified research peptides.

We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

Over the course of many years, we have empowered researchers and scientists to
explore new avenues of scientific discovery.

Inquiry History

3 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
LL37 peptide \|154947-66-7 \|LL-37 mechanism \|CAMP peptide \|COA available\| Bulk support \|99% Purity	Pharmaceutical Grade/99	$10/G FOB	HuaKeXin	Inquiry
LL37 375 high purity and High Quality 99% Purity with factory price	Pharmaceutical Grade/99	$22-23/UNIT FOB	Jielu Trading	Inquiry
LL-37/SNAP-8/TBHigh-purity and high-quality antibacterial research peptides. Available worldwide. Reliable merchants you can trust.	Cosmetics Grade/99.9	$36/UNIT FOB	dashu	Inquiry
LL37 99% freeze dried powder cas154947-66-7 senwayer 5mg	Pharmaceutical Grade/99	$96/UNIT FOB	Hangzhou Zhongqing Trading Co., Ltd	Inquiry
Factory direct sales high Purity peptide LL37 5mg white powder	Pharmaceutical Grade/99	$30-35/UNIT EXW	Yiwu Xiwu Technology Co., Ltd	Inquiry

MT1 | TongPeptides |COA 99.9 % Purity |

Product Description

Seller Information

Inquiry History

Classification of the substance or mixture

GHS label elements, including precautionary statements

Other hazards which do not result in classification

More Choices Find All Products for Sale 

Related Searches

More from this Seller