Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > Glucagon for Sale > XA30 XA30 High-quality peptides,white powder//provide home deliveryservice-available in stock in the warehouse99% purity + perfect after-sales service
XA30 XA30 High-quality peptides,white powder//provide home deliveryservice-available in stock in the warehouse99% purity + perfect after-sales service buy - large image1
XA30 XA30 High-quality peptides,white powder//provide home deliveryservice-available in stock in the warehouse99% purity + perfect after-sales service buy - image1
XA30 XA30 High-quality peptides,white powder//provide home deliveryservice-available in stock in the warehouse99% purity + perfect after-sales service buy - image2
XA30 XA30 High-quality peptides,white powder//provide home deliveryservice-available in stock in the warehouse99% purity + perfect after-sales service buy - image3
XA30 XA30 High-quality peptides,white powder//provide home deliveryservice-available in stock in the warehouse99% purity + perfect after-sales service buy - image4
XA30 XA30 High-quality peptides,white powder//provide home deliveryservice-available in stock in the warehouse99% purity + perfect after-sales service buy - image5
XA30 XA30 High-quality peptides,white powder//provide home deliveryservice-available in stock in the warehouse99% purity + perfect after-sales service buy - image6

XA30 XA30 High-quality peptides,white powder//provide home deliveryservice-available in stock in the warehouse99% purity + perfect after-sales service

4 Inquiries

Unit Price:

$30-35/UNIT FOB

Get Latest Price
CAS No.:

16941-32-5

Grade:

Research Grade

Content:

99%

Port:

HK

Brand:

Henan Kunyao

Packaging:

30mg*10vials

Price valid (until):

2026-12-30

Company Type:
Trader
Location:
China
Qualification:
Main Products:

PEPTIDES

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Contact information  


    Whatsapp:+86 199 399 68217 

    Mailbox: kyemi01che@163.com


      Our service 


    1. We supply peptides, APIs and intermediates to meet your needs;
    2. We will reply to your inquiry within 24 hours;
    3. Strictly select raw materials. Our Q&A team will strictly check the quality of each product before delivery;
    4. Reasonable and competitive price and fast delivery time;
    After delivery, we will help you track it every two days until you receive the product. When you receive the goods, if you have any questions, please contact us and we will provide you with a solution;
    6. 100% safe delivery and guaranteed delivery.


    Company profile  


    Focus on the research and development, production and customized services of high-quality peptides. With excellent technical strength and strict quality control system, the company provides reliable peptide products and solutions for scientific research institutions, pharmaceutical enterprises and biotechnology enterprises around the world.
    Strong ability to lay the foundation of quality.
    Advanced technology platform: equipped with internationally advanced peptide synthesis equipment and purification system, adopting cutting-edge technologies such as solid-phase synthesis (SPPS) and liquid-phase synthesis, it can support research and development from mg to kg, and ensure high purity and activity of products.
    Strict quality control: following the ISO 9001 quality management system, each batch of products has undergone multidimensional tests, including high performance liquid chromatography (HPLC) and mass spectrometry (MS), and complete quality inspection reports are provided to ensure the quality traceability of the whole production process.
    Efficient customized service: It has a professional R&D team, which can quickly respond to customers' needs, support complex sequence synthesis, customize modified peptide segments (such as ation, fluorescence labeling, polyethylene glycol modification, etc.), and provide one-stop service from solution design to delivery.


    Payment  


    Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 1 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 2 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 3 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 4 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 5


      FQA    


    Q: How to store it?
    Answer: If it has not been opened, put it in a cool and dry place; If opened, it can be refrigerated to 2-5 degrees.
    Q: How do I order this product?
    A: You can click "Contact Supplier", or send an email to my inbox, send a consultation, leave a message if possible, and we will contact you as soon as possible, and then discuss the details of the order.
    Q: What is the delivery time?
    A: Delivery will be made within 48 hours after receipt of payment. Small orders are delivered by express delivery. The goods will arrive in about 7 to 10 days.
    Q: Is it cash on delivery?
    A: In most cases, we don't support cash on delivery.
    Q: What is the price of the goods?
    A: As we all know, the price of chemicals is not fixed, but fluctuates with the market.
    You need to contact me to get the latest product price, and we guarantee to provide you with the most favorable price.
    Q: About after-sales service?
    A: After purchasing our products, we have a professional technical team and after-sales team to serve you and solve all your future problems.



    Product Detail 


    1. Fat metabolism research: Explore lipolysis pathways and study the regulatory mechanism of lipolysis in animal models.
    2. Metabolic regulation research: Observe energy metabolism in animal experiments and investigate physiological signaling pathways related to body weight.
    3. Cartilage and joint research: Investigate chondrocyte proliferation and joint tissue repair in in vitro and animal models.
    4. Bone metabolism research: Conduct experiments related to osteocytes to explore the mechanisms of bone remodeling and bone matrix synthesis.



    5. Items Information
      Full Product Name XA30 Research Peptide Lyophilized Powder (AOD9604)
      CAS No. 221231-10-3
      Appearance White lyophilized powder
      Purity ≥99% (HPLC Tested)
      Storage Condition Store sealed, protected from light at -20°C; store at 2–8°C after reconstitution. Avoid repeated freeze-thaw cycles





    6. Shop XA30 XA30 High-quality peptides,white powder//provide home deliveryservice-available in stock in the warehouse99% purity + perfect after-sales service-Detailed Image 6 Shop XA30 XA30 High-quality peptides,white powder//provide home deliveryservice-available in stock in the warehouse99% purity + perfect after-sales service-Detailed Image 7

    Items Specifications
    CAS NO 16941-32-5
    Storage Dry powder: Store at -20℃;After reconstitution store at 2°C‑8°C
    Purity ≥99%


       Transportation and packaging




      Product Detail  


    Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 10 Shop Retatrutide LY-3437943 CAS 2381089-83-2 High Purity Synthetic Peptide Research Grade-Detailed Image 11

    Shop G210 High-Quality Pharmacy Grade G210 High-Purity Peptide Fast Deliveryperfect after-sales service-Detailed Image 10 Shop G210 High-Quality Pharmacy Grade G210 High-Purity Peptide Fast Deliveryperfect after-sales service-Detailed Image 11

    ECHEMI Editorial Reference
    White or almost white powderProduced by the α cells of the islands of Langerhans and also by the gastric mucosa. It is opposite in effect to insulin. It appears to be a straight-chain polypeptide with a molecular weight of approximately 3500. Small amounts have been detected in commproduced by recombinant DNA technology ismarketed by Novo Nordisk (glucagon [recombinant] hydrochloride,GlucaGen HypoKit, GlucaGen Diagnostic Kit)and by Eli Lilly (glucagon [recombinant] Emergency Kit). The hypergly
    Research & Reference Note

    XA30 XA30 High-quality peptides,white powder//provide home deliveryservice-available in stock in the warehouse99% purity + perfect after-sales service is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    Glucagon

    Other Name:

    GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN

    CAS No.:

    16941-32-5

    Molecular Formula:

    C153H225N43O49S

    InChIKeys:

    MASNOZXLGMXCHN-ZLPAWPGGSA-N

    Molecular Weight:

    3482.75

    Exact Mass:

    3480.615723

    EC Number:

    232-708-2

    HScode:

    2937190000

    Categories:

    Polypeptide

    Characteristics
    PSA:

    1564.04000

    XLogP3:

    -6.01

    Appearance:

    powder

    Density:

    1.53±0.1 g/cm3(Predicted)

    Refractive Index:

    1.682

    Water Solubility:

    Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.

    Storage Conditions:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Skin sensitization, Category 1

    Acute toxicity - Category 4, Inhalation

    Respiratory sensitization, Category 1

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Danger

    Hazard statement(s)

    H317 May cause an allergic skin reaction

    H332 Harmful if inhaled

    H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled

    Precautionary statement(s)
    Prevention

    P261 Avoid breathing dust/fume/gas/mist/vapours/spray.

    P272 Contaminated work clothing should not be allowed out of the workplace.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    P271 Use only outdoors or in a well-ventilated area.

    P284 [In case of inadequate ventilation] wear respiratory protection.

    Response

    P302+P352 IF ON SKIN: Wash with plenty of water/...

    P333+P317 If skin irritation or rash occurs: Get medical help.

    P321 Specific treatment (see ... on this label).

    P362+P364 Take off contaminated clothing and wash it before reuse.

    P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing.

    P317 Get medical help.

    P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.

    Storage

    none

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    PEPTIDES

    Location:

    Room 305, 3rd Floor, Unit 2, Building 48, Datangxia Zone 2, Choucheng Subdistrict, Yiwu, Jinhua, Zhejiang Province, China

    Year of Establishment:

    2026

  • Inquiry History
    4 Inquiries
    Country Product Purchase Quantity Date Posted
    Belgium

    Glucagon 16941-32-5 Pharmaceutical grade

    10 PCS Jan 8, 2026
    Belgium

    Glucagon (1-29)

    5 MG Jan 9, 2026
    Netherlands

    glucagon

    1000 KG Feb 15, 2024
    Bulgaria

    Glucagon, not retatrutide, just glucagon

    1 G May 10, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.