Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Skin Humectant > Glucagon for Sale > Warehouse In Stock Hot Selling 99% High Purity Glucagon Peptide Powder CAS 16941-32-5 Factory Direct Supply
Warehouse In Stock Hot Selling 99% High Purity Glucagon Peptide Powder CAS 16941-32-5 Factory Direct Supply buy - large image1
Warehouse In Stock Hot Selling 99% High Purity Glucagon Peptide Powder CAS 16941-32-5 Factory Direct Supply buy - image1
Warehouse In Stock Hot Selling 99% High Purity Glucagon Peptide Powder CAS 16941-32-5 Factory Direct Supply buy - image2
Warehouse In Stock Hot Selling 99% High Purity Glucagon Peptide Powder CAS 16941-32-5 Factory Direct Supply buy - image3
Warehouse In Stock Hot Selling 99% High Purity Glucagon Peptide Powder CAS 16941-32-5 Factory Direct Supply buy - image4
Warehouse In Stock Hot Selling 99% High Purity Glucagon Peptide Powder CAS 16941-32-5 Factory Direct Supply buy - image5
Warehouse In Stock Hot Selling 99% High Purity Glucagon Peptide Powder CAS 16941-32-5 Factory Direct Supply buy - image6

Warehouse In Stock Hot Selling 99% High Purity Glucagon Peptide Powder CAS 16941-32-5 Factory Direct Supply

TDS 4 Inquiries

Unit Price:

$150-180/KG FOB

Get Latest Price
CAS No.:

16941-32-5

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Xi'an

Brand:

FULECARE

Packaging:

Double plastic bags plus aluminum foil bag

Price valid (until):

2027-11-30

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Slu-pp-332,BAM 15

  • Product Description

  • Seller Information

  • Inquiry History

  • Description



    Shop Factory Supply Collagen Type III Powder CAS 9007-34-5 Cosmetic Skin Repair Anti-Aging Raw Material-Detailed Image 1

    Product Name Glucagon Powder
    Part of Use Glucagon
    Grade  pharmaceutical Grade
    Appearance white powder
    Specification 99%
    Test Method  HPLC
    Shelf life 24 Months
    Storage Cool Dry Place

    Glucagon is a linear polypeptide hormone secreted by pancreatic alpha cells. It can raise blood glucose levels by promoting hepatic glycogen decomposition and gluconeogenesis. Widely applied in endocrinology, glucose metabolism, diabetes-related pharmaceutical and cell laboratory research. HPLC tested purity up to 99%, white lyophilized powder with stable properties. Goods in local warehouse for fast delivery, competitive factory wholesale price, bulk orders supported.

    Shop Pharmaceutical CAS 1792180-81-4 Ritlecitinib Powder Ritlecitinib-Detailed Image 2 Shop Pharmaceutical CAS 1792180-81-4 Ritlecitinib Powder Ritlecitinib-Detailed Image 3 Shop Pharmaceutical CAS 1792180-81-4 Ritlecitinib Powder Ritlecitinib-Detailed Image 4

    Xi’an Fulecare biotech has high-technique enterprises with 10 years history,dedicate to separation, purification of the natural active ingredients production and sales.

    We also produce international frontier dietary supplements such as granulated powder,solid drinks,tea sachets, capsules and tablets etc.

    We have high grade clean workshop,800 square meters of inspection center equipped with more than 10 sets of HPLC,GC,IR,MASS instruments,these provides a full range of quality assurance to our products

    The company has a perfect quality assurance system.We implement strict quality control standards and have passed the certification for the ISO9001 Quality Management System. The Quality Management Department is equipped with many sets of high performance liquid chromatography (HPLC)instruments, ultraviolet spectrophotometers (UV), several spectropolarimeters, a gas chromatograph (GC), melting point apparatus, and other advanced testing and experimental equipment. We make a detailed division of labor for technology research, and for quality assurance and quality control, so that we can conduct effective and comprehensive quality control in the production process. This also allows us to make comprehensive detection analysis of final products, thus ensuring products quality.

    Our Services


    Shop Pharmaceutical CAS 1792180-81-4 Ritlecitinib Powder Ritlecitinib-Detailed Image 5 Shop Pharmaceutical CAS 1792180-81-4 Ritlecitinib Powder Ritlecitinib-Detailed Image 6

    Packaging & Shipping


    Shop Pharmaceutical CAS 1792180-81-4 Ritlecitinib Powder Ritlecitinib-Detailed Image 7

    DHL Around 3-5 working days
    Fedex Around 4-6 working days
    UPS Around 4-6 working days
    By Air Around 5-7 working days
    By Sea Around 15-30 working days


    Package

    Powder:1kg per bag,25kg per Carton or Drum

    PE bag, glass bottle, or PTFE bottle for inner packing, and aluminum foil bag for outer packing.

    Liquid: glass bottle or PTFE bottle for inner packing, and aluminum foil bag for outer packing.

    Bulk order: Fiber drum or steel drum.

    Payment options T/T,Paypal,Visa,L/C or according to your needs.

    Transportation
     
    UPS,TNT,EMS,Fedex,and so on.According to your location, safe customs clearance, generally delivered to your door within 3-7 days in Europe and the United States.

    Shop Pharmaceutical CAS 1792180-81-4 Ritlecitinib Powder Ritlecitinib-Detailed Image 8 Shop Pharmaceutical CAS 1792180-81-4 Ritlecitinib Powder Ritlecitinib-Detailed Image 9 Shop Pharmaceutical CAS 1792180-81-4 Ritlecitinib Powder Ritlecitinib-Detailed Image 10

    ut...

    Certificates

    Basic Info
    Product Name:

    Glucagon

    Other Name:

    GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN

    CAS No.:

    16941-32-5

    Molecular Formula:

    C153H225N43O49S

    InChIKeys:

    MASNOZXLGMXCHN-ZLPAWPGGSA-N

    Molecular Weight:

    3482.75

    Exact Mass:

    3480.615723

    EC Number:

    232-708-2

    HScode:

    2937190000

    Categories:

    Skin Humectant

    Characteristics
    PSA:

    1564.04000

    XLogP3:

    -6.01

    Appearance:

    powder

    Density:

    1.53±0.1 g/cm3(Predicted)

    Refractive Index:

    1.682

    Water Solubility:

    Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.

    Storage Conditions:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Skin sensitization, Category 1

    Acute toxicity - Category 4, Inhalation

    Respiratory sensitization, Category 1

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Danger

    Hazard statement(s)

    H317 May cause an allergic skin reaction

    H332 Harmful if inhaled

    H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled

    Precautionary statement(s)
    Prevention

    P261 Avoid breathing dust/fume/gas/mist/vapours/spray.

    P272 Contaminated work clothing should not be allowed out of the workplace.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    P271 Use only outdoors or in a well-ventilated area.

    P284 [In case of inadequate ventilation] wear respiratory protection.

    Response

    P302+P352 IF ON SKIN: Wash with plenty of water/...

    P333+P317 If skin irritation or rash occurs: Get medical help.

    P321 Specific treatment (see ... on this label).

    P362+P364 Take off contaminated clothing and wash it before reuse.

    P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing.

    P317 Get medical help.

    P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.

    Storage

    none

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Slu-pp-332,BAM 15

    Location:

    No. 11608, 16th Floor, Unit 1, Building 1, West of Zhangba Liu Road, South Third Ring Road, High tech Zone, Xi'an City, Shaanxi Province

    Payment Terms:

    L/C,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    335

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    11-50

    Year of Establishment:

    2025

  • Inquiry History
    4 Inquiries
    Country Product Purchase Quantity Date Posted
    Belgium

    Glucagon 16941-32-5 Pharmaceutical grade

    10 PCS Jan 8, 2026
    Belgium

    Glucagon (1-29)

    5 MG Jan 9, 2026
    Netherlands

    glucagon

    1000 KG Feb 15, 2024
    Bulgaria

    Glucagon, not retatrutide, just glucagon

    1 G May 10, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.