Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Glucagon for Sale > GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep
GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep buy - large image1
GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep buy - image1
GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep buy - image2
GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep buy - image3
GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep buy - image4
GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep buy - image5
GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep buy - image6

GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep

TDS 4 Inquiries

Unit Price:

$41/UNIT FOB

Get Latest Price
CAS No.:

16941-32-5

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Hongkong

Brand:

Novio

Packaging:

2mg*10vials

Sample Available:

Yes

Price valid (until):

2026-10-18

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides,Cosmetic Raw Materials,Pharmaceutical Intermediates

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    WhatsApp +852 9339 8574
    GND2 is a synthetic decapeptide—specifically the acetate form of naturally occurring gonadotropin-releasing hormone (GnRH)—that holds a significant position in the field of reproductive endocrine regulation. As a key upstream regulator of the hypothalamic-pituitary-gonadal (HPG) axis, Gonadorelin serves as a vital signaling molecule for initiating and maintaining the secretion of reproductive hormones. Due to its central role in sex hormone regulation, it is widely utilized in reproductive medicine, endocrine research, and pharmaceutical development. Characterized by a well-defined structure, a clear mechanism of action, and controllable effects, GND2 has become an indispensable tool for studying the regulation of the gonadal axis.
    In terms of its mechanism of action, the core function of Gonadorelin lies in the regulation of sex hormone secretion. It binds to specific receptors, triggering the pituitary gland to release two key gonadotropins: luteinizing hormone (LH) and follicle-stimulating hormone (FSH). These hormones subsequently act on the gonads to drive the synthesis and secretion of sex hormones, thereby influencing the normal functioning of the reproductive system. This hierarchical regulatory model—spanning the upstream signal, the pituitary, and the gonads—positions Gonadorelin as a pivotal element in reproductive endocrine regulation; its activity directly determines the stability and balance of downstream hormone levels. As the acetate form, GND2 retains this core regulatory function while offering enhanced stability and controllability, facilitating standardized research and application.
    GND2 demonstrates significant value in the field of reproductive endocrine research. Stable sex hormone levels are fundamental to the normal functioning of the reproductive system, and Gonadorelin serves as a critical regulatory node in maintaining this balance. By evaluating the activity and effects of Gonadorelin, researchers can gain insight into the functional status of various components of the gonadal axis, providing a basis for diagnosing and studying related endocrine disorders. In clinical research, Gonadorelin is also used to assess functional responses in specific contexts—such as evaluating the responsiveness of the pituitary and gonads—thereby informing the development of intervention strategies. This research approach—inferring overall system function by analyzing a specific regulatory node—makes GND2 a vital tool in reproductive medicine and endocrine research. Beyond its fundamental regulatory functions, the effects of Gonadorelin are closely linked to the mode of administration and dosage, demonstrating clear dose-dependency. Under specific conditions, it can transiently boost gonadotropin release, facilitating the assessment of the immediate response of the gonadal axis; conversely, sustained action may modulate receptor status to achieve a different regulatory outcome. This bidirectional regulatory capability—allowing for flexible, reversible modulation—offers significant versatility in research, enabling the design of specific modes of action tailored to diverse research objectives and providing robust support for exploring the regulatory mechanisms of the gonadal axis.
    Regarding its application profile, GND2, as a synthetic peptide, boasts distinct advantages such as a well-defined structure, controllable purity, and batch-to-batch consistency. Its mature synthesis process ensures product quality and standardization, making it ideal for standardized research and development. Furthermore, its mechanism of action and target are clearly defined, and the regulatory process is relatively controllable, facilitating precise research and dosage optimization. These characteristics—structural clarity, a clear mechanism, and controllable effects—render it highly valuable for both basic research and applied development in the field of reproductive endocrinology.
    Safety considerations require an objective view of the current status of GND2 usage. As a research-grade peptide, GND2 is primarily utilized in laboratory studies, functional assessments, and exploratory applications; its specific effects depend heavily on factors such as dosage and the physiological state of the subject. Consequently, any research or application must be grounded in comprehensive understanding and standardized evaluation, adhering to scientific principles to avoid indiscriminate use. Research teams continue to conduct assessments to deepen the understanding of its mechanisms and effects, thereby providing a solid foundation for future applications.
    From an industry perspective, GND2 represents a significant direction in reproductive endocrine regulation research. Its approach—combining the biological functions of natural regulatory factors with the stability of synthetic peptides—provides a reliable tool for studying sex hormone regulation. Unlike compounds with broad, non-specific effects, Gonadorelin aligns with the precision requirements of reproductive medicine and endocrinology research due to its well-defined targets, clear mechanisms, and controllable dosage, serving as a crucial foundation for studies in this field. As research progresses, its potential value in areas such as reproductive function assessment and endocrine regulation is expected to be further realized. Naturally, there remains a wealth of information regarding GND2 yet to be explored. Questions concerning individual variations in response to Gonadorelin, its overall performance during long-term use, and its interactions with other active substances require answers through further research. Only by conducting thorough studies and establishing a robust body of evidence can its practical value and future prospects be accurately assessed—a process that reflects the fundamental principles of scientific inquiry: a step-by-step approach that prioritizes evidence.
    Overall, GND2 (Gonadorelin acetate) demonstrates unique value in reproductive endocrinology research and related applications, owing to its pivotal role in sex hormone regulation and its well-defined structure, clear mechanism of action, and controllable effects. It serves not only as a vital tool in reproductive medicine research but also as a key window into understanding the regulatory mechanisms of the gonadal axis. By enabling precise control over gonadotropin release and sex hormone secretion, GND2 provides solid support for research in reproductive endocrinology and serves as a crucial reference and foundation for the development of related drugs and products.

    Items Specifications
    Name GND2
    CAS Number 16941-32-5
    Grade Pharmaceutical Grade
    Specification 2mg
    Purity ≥99% 
    Appearance White Lyophilized Powder
    Shop GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep-Detailed Image 1
    Shop GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep-Detailed Image 2
    Shop GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep-Detailed Image 3
    Shop GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep-Detailed Image 4
    Shop GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep-Detailed Image 5
    Shop GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep-Detailed Image 6
    Shop GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep-Detailed Image 7
    Shop GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep-Detailed Image 8
    Shop GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep-Detailed Image 9
    Shop GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep-Detailed Image 10
    ECHEMI Editorial Reference
    White or almost white powderProduced by the α cells of the islands of Langerhans and also by the gastric mucosa. It is opposite in effect to insulin. It appears to be a straight-chain polypeptide with a molecular weight of approximately 3500. Small amounts have been detected in commproduced by recombinant DNA technology ismarketed by Novo Nordisk (glucagon [recombinant] hydrochloride,GlucaGen HypoKit, GlucaGen Diagnostic Kit)and by Eli Lilly (glucagon [recombinant] Emergency Kit). The hypergly
    Research & Reference Note

    GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • GND2, GND2 Peptide, Synthetic Peptide, Bioactive Peptide, Active Peptide, Skincare Peptide, Anti-aging Ingredient, Cosmetic Raw Material, Research Pep Certificates 1 TDS

    Basic Info
    Product Name:

    Glucagon

    Other Name:

    GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN

    CAS No.:

    16941-32-5

    Molecular Formula:

    C153H225N43O49S

    InChIKeys:

    MASNOZXLGMXCHN-ZLPAWPGGSA-N

    Molecular Weight:

    3482.75

    Exact Mass:

    3480.615723

    EC Number:

    232-708-2

    HScode:

    2937190000

    Characteristics
    PSA:

    1564.04000

    XLogP3:

    -6.01

    Appearance:

    powder

    Density:

    1.53±0.1 g/cm3(Predicted)

    Refractive Index:

    1.682

    Water Solubility:

    Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.

    Storage Conditions:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Skin sensitization, Category 1

    Acute toxicity - Category 4, Inhalation

    Respiratory sensitization, Category 1

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Danger

    Hazard statement(s)

    H317 May cause an allergic skin reaction

    H332 Harmful if inhaled

    H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled

    Precautionary statement(s)
    Prevention

    P261 Avoid breathing dust/fume/gas/mist/vapours/spray.

    P272 Contaminated work clothing should not be allowed out of the workplace.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    P271 Use only outdoors or in a well-ventilated area.

    P284 [In case of inadequate ventilation] wear respiratory protection.

    Response

    P302+P352 IF ON SKIN: Wash with plenty of water/...

    P333+P317 If skin irritation or rash occurs: Get medical help.

    P321 Specific treatment (see ... on this label).

    P362+P364 Take off contaminated clothing and wash it before reuse.

    P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing.

    P317 Get medical help.

    P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.

    Storage

    none

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides,Cosmetic Raw Materials,Pharmaceutical Intermediates

    Location:

    Room 1359, Room 103, Building Jia 19, Jixiang Garden, Tongzhou District, Beijing

    Year of Establishment:

    2026

  • Inquiry History
    4 Inquiries
    Country Product Purchase Quantity Date Posted
    Belgium

    Glucagon 16941-32-5 Pharmaceutical grade

    10 PCS Jan 8, 2026
    Belgium

    Glucagon (1-29)

    5 MG Jan 9, 2026
    Netherlands

    glucagon

    1000 KG Feb 15, 2024
    Bulgaria

    Glucagon, not retatrutide, just glucagon

    1 G May 10, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.