Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL-37 High-Grade Research Peptide Lyophilized For Antimicrobial Defense Preclinical Testing
LL-37 High-Grade Research Peptide Lyophilized For Antimicrobial Defense Preclinical Testing buy - large image1
LL-37 High-Grade Research Peptide Lyophilized For Antimicrobial Defense Preclinical Testing buy - image1
LL-37 High-Grade Research Peptide Lyophilized For Antimicrobial Defense Preclinical Testing buy - image2
LL-37 High-Grade Research Peptide Lyophilized For Antimicrobial Defense Preclinical Testing buy - image3
LL-37 High-Grade Research Peptide Lyophilized For Antimicrobial Defense Preclinical Testing buy - image4
LL-37 High-Grade Research Peptide Lyophilized For Antimicrobial Defense Preclinical Testing buy - image5
LL-37 High-Grade Research Peptide Lyophilized For Antimicrobial Defense Preclinical Testing buy - image6

LL-37 High-Grade Research Peptide Lyophilized For Antimicrobial Defense Preclinical Testing

TDS 3 Inquiries

Unit Price:

$100/MT EXW

Get Latest Price
CAS No.:

154947-66-7

Grade:

Cosmetics Grade

Content:

99%

Port:

guangzhou

Brand:

chunqiao

Packaging:

5mg10vials,10 Vials per kit

Sample Available:

Yes

Price valid (until):

2026-10-24

Company Type:
Trader
Location:
China
Payment Terms:
100% TT in advance
Qualification:
Main Products:

peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Shop Glucagon Like Peptide Bioactive Hormone For Incretin Pathway Assay Profiling-Detailed Image 1

    Key Specifications/ Special Features:

    Peptide products is a high-quality product, and with stock and safe shipping service. we have 200 kinds+ peptides for option, and with business all over the world. establish stable cooperation relationship.


    Peptide Purity: 99%


    Small Orders:Accepted


    eptide Form: Lyophilized Powder


    Dose: 2mg 5mg 10mg 20mg 30mg 40mg 50mg 60mg 100mg vials


    Package: 10 vials/kit


    Sample Orders:Accepted


    Inventory status: We have our own factory in China and also have warehouses in the United States. The inventory is sufficient and there are goods available for shipment and sale.


    We also accept custom orders, including bottle caps and products in larger dosage specifications.


    Shipping time: usaully 3-10 days


    Shipping method:DHL, USPS, UPS, special line,act


    Our Advantage

    1. Rich experience.
    Our company is a professional production leading factory in China in pharmaceutical area of many years, our products have exported to Germany, Spain, UK, USA, Australia, Middle East, and so on other country, and we have got very good feedback from our customers, we had Established long friendly relations of cooperation.

    2. Great quality, purity and favourable.
    Good quality is one of our secret success, welcome order the samples, MOQ just 1 BOX.

    3. Safe and fast delivery.
    We have stock, so we can delivery quickly at the very day when receive the payment.

    4. Good after-sales service.

    Tell me the package update, and will try best solve when customer encountered various problems.

    Shop LL-37 High-Grade Research Peptide Lyophilized For Antimicrobial Defense Preclinical Testing-Detailed Image 2 Shop LL-37 High-Grade Research Peptide Lyophilized For Antimicrobial Defense Preclinical Testing-Detailed Image 3              Shop Glucagon Like Peptide Bioactive Hormone For Incretin Pathway Assay Profiling-Detailed Image 4 Shop Glucagon Like Peptide Bioactive Hormone For Incretin Pathway Assay Profiling-Detailed Image 5  Shop Glucagon Like Peptide Bioactive Hormone For Incretin Pathway Assay Profiling-Detailed Image 6 Shop Glucagon Like Peptide Bioactive Hormone For Incretin Pathway Assay Profiling-Detailed Image 7 Shop Glucagon Like Peptide Bioactive Hormone For Incretin Pathway Assay Profiling-Detailed Image 8



    Parameter Value
    Specification 2mg 5mg 10mg 20mg 30mg
    Purity 99.50%
    Payment Method BTC, USDT, Bank Transfer
    Origin China
    Weight per Unit 0.5 Grams
    Units per Export Carton 10
    Export Carton Weight 0.5 Kilograms
    Export Carton Dimensions (L/W/H) 15.0 x 16.0 x 16.0 Centimeters
    Main Export Markets Asia/Australasia; Central/South America; Eastern Europe; Mid East/Africa; North America; Western Europe
    Factory Size 2000 Square Metres
    Number of Production Staff 10 to 19


    DO YOU ACCEPT SAMPLE ORDER?
    We accept sample orders. We will make samples before mass production, and after sample approved, we'll begin mass production. Doing 100% inspection during production, then do random inspection before packing.


    2.HOW TO CONFIRM THE PRODUCT QUALITY BEFORE PLACING ORDERS?
    You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.

    3.WHAT'S YOUR MOQ?
    Our MOQ is 1BOX.

    4.DO YOU SUPPLY PRODUCT REPORT?
    Yes. We'll give you product analysis report before shipping.

    5.IS THERE A DISCOUNT?
    Different quantity has different discount.

    Guangzhou Chunqiao Trading Co., Ltd   a manufacturer specializing in the research, development, production, sales and service of tanning products, such as tanning sprays, tanning drops, cosmetic peptides, and polypeptides. We always regard the value of our customers as our top priority. We focus on high quality, competitive prices, flexible order quantities, and timely delivery. Our products are mainly exported to customers in European countries, the United States, and Australia. Our products are widely recognized and trusted by users. We also welcome OEM and ODM orders. Being in cooperation with all brands is a great honor and privilege, regardless of whether the brand is a start-up enterprise. We look forward to your every visit. We welcome both new and old customers to contact us to establish future business relationships and achieve mutual success together! Our multilingual team is proficient in international trade regulations and provides end-to-end services ranging from market research, product procurement, quality control, customs clearance to logistics management, ensuring safe and efficient transactions. Customer-centricity and compliance are our cornerstones. We prioritize product quality, timely delivery, and risk mitigation. Through professionalism and accountability, we build trust and become the most reliable global trading partners. We elevate "Made in China" to the world stage and redefine cross-border commerce with simplicity and intelligence.

    Shop High Purity Tirzepatide Peptide Lyophilized Powder Raw Material for Research-Detailed Image 4

    Shop High Purity Tirzepatide Peptide Lyophilized Powder Raw Material for Research-Detailed Image 5












      Product Detail  



    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL-37 High-Grade Research Peptide Lyophilized For Antimicrobial Defense Preclinical Testing is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • LL-37 High-Grade Research Peptide Lyophilized For Antimicrobial Defense Preclinical Testing Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptide

    Location:

    Unit 1-B2141, 19B-F1, 81-1 Nonglinxia Road, Yuexiu District, Guangzhou, China

    Payment Terms:

    100% TT in advance

    Year of Establishment:

    2026

    Company Profile
     

    Guangzhou Chunqiao Trading Co., Ltd.

    established in 202 6  and headquartered in Guangzhou  Province, is a comprehensive foreign trade enterprise integrating the research and development of peptides, raw material procurement, and sales. With a registered capital of 1 million USD and international certifications, our business spans 30 countries and regions, achieving an annual export volume exceeding 200 million USD. Leveraging a global supply chain system and a digital trading platform, we are dedicated to providing high-quality products and customized procurement solutions for overseas customers.

    Core Business and Products
    Our core operations encompass a cross-border trade agency, offering end-to-end services including import and export customs declaration, logistics clearance, and foreign exchange settlement. We also provide OEM/ODM services, specializing in product design, production, and private label processing for international brands. Furthermore, our supply chain management expertise allows us to integrate high-quality domestic manufacturing resources, establishing a vertical supply network from raw materials to finished goods. Our key product lines are in the chemical industry, focusing on raw materials, and the organic sector, featuring organic ecological products and plant extracts.
    Core Competitiveness

    • Full-chain service system: Establish a four-dimensional integrated system encompassing procurement, quality inspection, logistics and after-sales service, implementing a 48-hour rapid response mechanism with a customer complaint rate below 0.5%.

     

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.