LL-37 High-Grade Research Peptide Lyophilized For Antimicrobial Defense Preclinical Testing
TDS 3 Inquiries
154947-66-7
Cosmetics Grade
99%
guangzhou
chunqiao
5mg10vials,10 Vials per kit
Yes
2026-10-24
peptide
-
Product Description
-
Seller Information
-
Inquiry History
-
DescriptionECHEMI Editorial ReferenceLL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.Research & Reference Note
LL-37 High-Grade Research Peptide Lyophilized For Antimicrobial Defense Preclinical Testing is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Authoritative sourcesDisclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals
Certificates-
TDS
Basic Info-
Product Name:
LL-37
Other Name:Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate
CAS No.:154947-66-7
Molecular Formula:C205H340N60O53
InChIKeys:POIUWJQBRNEFGX-XAMSXPGMSA-N
Molecular Weight:0
EC Number:211-519-9
Color/Form:White to off-white
Categories:
Characteristics-
Water Solubility:
Soluble to 1 mg/ml in water
-
-
Seller Information
-
Business Type:
Trader
-
Main Products:
peptide
-
Location:
Unit 1-B2141, 19B-F1, 81-1 Nonglinxia Road, Yuexiu District, Guangzhou, China
-
Payment Terms:
100% TT in advance
-
Year of Establishment:
2026
-
-
Inquiry History3 Inquiries
Country Product Purchase Quantity Date Posted
Indonesia
LL 37
1 Aug 6, 2026
Indonesia
LL 37
1 Aug 6, 2026
Indonesia
LL-37
5 MG Jun 23, 2026 Post an enquiry for this product
- Hot Searches
- acryloyl chloride sds
- johnson matthey catalysts
- pet prices
- pharma chemical suppliers
- can you purchase formaldehyde
- ambeed 87736-88-7 price
- ammonium nitrate fertilizer form prills
- fluocinolone acetonide oil ear drops 0.01 price
- crude oil prices this morning
- ldpe resin price asia 2025 english
- dicalcium phosphate supplier
- sds for sodium bicarbonate
More from this Seller
-
-
-
Melanotan II Peptide For Pigmentation And Skin Tanning Research, Supplied In Lyophilized Vials
Cosmetics Grade / 99%
$54/MT EXW
-
-
-
-
Glutathione High-Grade Research Compound Lyophilized For Antioxidant Research Programs
Cosmetics Grade / 99%
$77/MT EXW
-
-
-
-
Mazdutide Multi Receptor Hormone Peptide For Metabolic Disease And Body Weight Studies
Cosmetics Grade / 99%
$160/MT EXW
-
-
-
-
Selank Heptapeptide With Anxiolytic Properties, Research Grade Material For Neurobiology Assays
Cosmetics Grade / 99%
$45/MT EXW
-
-
-
-
Hyaluronic Acid High Molecular Weight Polymer For Dermatology And Moisturizing Product Research
Cosmetics Grade / 99%
$30/MT FOB
-