Product
Supplier
Encyclopedia
Inquiry
Home > Chemical Reagents > Organic Reagents > LL-37 for Sale > Good price peptides factory supply peptide Best peptide powder safe shipping
Good price peptides factory supply peptide Best peptide powder safe shipping buy - large image1
Good price peptides factory supply peptide Best peptide powder safe shipping buy - image1
Good price peptides factory supply peptide Best peptide powder safe shipping buy - image2
Good price peptides factory supply peptide Best peptide powder safe shipping buy - image3
Good price peptides factory supply peptide Best peptide powder safe shipping buy - image4
Good price peptides factory supply peptide Best peptide powder safe shipping buy - image5
Good price peptides factory supply peptide Best peptide powder safe shipping buy - image6

Good price peptides factory supply peptide Best peptide powder safe shipping

1 Inquiries

Unit Price:

$45-55/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Chemical Grade

Content:

99%

Port:

qingdao

Packaging:

1box=10vilas

Price valid (until):

2027-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Our peptide factory produces peptides of various specifications and provides purity of up to 99%.

    If there are any quality problems after purchase, we will reissue them for free.

    Your trust is our greatest motivation, welcome to contact me!

    Please use it correctly under the guidance of a professional.


    Shop Hot Selling Factory High Purity Peptide Slimming Lyophilized Powder-Detailed Image 1

    Shop Hot Selling Factory High Purity Peptide Slimming Lyophilized Powder-Detailed Image 2

    Weight management: Retatrutide is being developed for weight loss treatment. It can stimulate multiple targets, suppress appetite, increase satiety, reduce food intake, and help patients significantly lose weight.
    Metabolic improvement:
    Not only can it help obese patients lose weight, but it can also improve metabolic problems related to obesity, such as hypertension, hyperlipidemia, etc.
    Blood sugar control:
    Ritaglutide can enhance inhibit glucagon secretion by stimulating GLP-1 and other receptors, thereby effectively reducing blood sugar levels. Therefore, it has good blood sugar control effect on type 2 diabetes patients.
    Multi effect mechanism: Ritaglutide activates multiple receptors (GLP-1, GIP, and glucagon receptor), which may have a more significant effect on blood glucose control and a more comprehensive metabolic regulatory ability compared to traditional single target GLP-1 agonists.


      Product parameter


    Items Specifications
    CAS number 154947-66-7
    Product synonyms peptide product 
    Product name LL37
    Molecular formula C205H340N60O53
    Storage conditions Refrigeration Keep Dry and Away From Light


    Shop Hot Selling Factory High Purity Peptide Slimming Lyophilized Powder-Detailed Image 3

    We have many peptides,semaglutide tirzepatide,retatrutide,bac water,steriods,MT2,Nad+ ,pills; weight sliming.etc.It can also be customized according to your requirements.Any question pls feel free to contact me at any time.

    Note: Due to policy changes, some products have not been disclosed on here. However, you can still ask us for quotations via email, phone, WhatsApp and WeChat.

    If you couldn't find the product you want in our store, maybe we haven't uploaded the complete product, please feel free to contact us through various ways; if you want to customize and process the product you want, please feel free to contact us for more details too.


    Shop Hot Selling Factory High Purity Peptide Slimming Lyophilized Powder-Detailed Image 4
    Shop Hot Selling Factory High Purity Peptide Slimming Lyophilized Powder-Detailed Image 5

    Packing:

    10mg/vial 10vials/box

    15mg/vial 10vials/box

    20mg/vial 10vials/box

    30mg/vial 10vials/box



      FAQ  


    1. How to make an order?
    Send me message and let me know what you need with quantity , then i will calculate to you

    2. What's the lead time and shipping ways?
    We will delivery to the package by USPS, FEDEX, DHL paket and YANWEN express to you after receive your payment, it would take around 5-15 days to your address.

    3. How do i keep the peptides when i receive it ?
    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    4. What's the payment methods?
    We could accept pay through paypal,bank transfer, X-Transfer and bitcoin.


      Company Profile


    Shop Hot Selling Factory High Purity Peptide Slimming Lyophilized Powder-Detailed Image 6

    Our production system is GMP and ISO certified. Our product testing processes are rigorously monitored to ensure the highest quality for our customers. From raw materials to finished products, we rigorously inspect every step of the production process. With a 99% customs clearance rate, we guarantee the safe transportation of our customers' goods and guarantee the accuracy of their deliveries.


    Our Service


    Shop Hot Selling Factory High Purity Peptide Slimming Lyophilized Powder-Detailed Image 7

    1. Fast Delivery: We can delivery within 24 hours upon receipt of your payment.
    2. Quality can be promised. Hot sell to Worldwide.
    3. Payment Terms: T/T,BTC, PayPal, , MoneyGram, TT, Alipay, etc.
    4. Free Sample available at any time.
    5. Tracking your order at any time. Inform your order's further new situation at any time.
    6. Package: Professional packing with professional materials.


     Contact Info


    Tonya

    Email:w19921210w@gmail.com

    WhatsApp: +85247340205

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Organic Reagents

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptide

    Location:

    Tianjin City

    Year of Establishment:

    2025

    Company PrTianjin Aobos Cosmetics Co., Ltd.
  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.