 Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 99% Freeze-dried powder 375 In stock Minimum Order| High quality

LL37 99% Freeze-dried powder 375 In stock Minimum Order| High quality buy - large image1

LL37 99% Freeze-dried powder 375 In stock Minimum Order| High quality buy - image1

LL37 99% Freeze-dried powder 375 In stock Minimum Order| High quality buy - image2

LL37 99% Freeze-dried powder 375 In stock Minimum Order| High quality buy - image3

LL37 99% Freeze-dried powder 375 In stock Minimum Order| High quality buy - image4

LL37 99% Freeze-dried powder 375 In stock Minimum Order| High quality

Name: LL37 99% Freeze-dried powder 375 In stock Minimum Order| High quality
Brand: Tong Peptides
SKU: pr2610161800
Price: 75 USD
Availability: InStock

TDS 4 Inquiries

Unit Price:

$75-90/UNIT FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

High Purity Grade

Content:

99%

Port:

Shenzhen

Brand:

Tong Peptides

Packaging:

10mg/vial, 10 vials/box

Sample Available:

Yes

Price valid (until):

2027-04-09

Contact Supplier

 Chat Now

Tong peptides

Company Type:

Manufactory

Location:

China

Payment Terms:

TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Qualification:

Main Products:

retatrutide,TB-500,GHK-CU,peptide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Detail

Name:Chloe

Whatsapp:+852 6572 8571

Email Address:chloe@tongpeptides.com

What is LL37?

LL37 is catalog designation for Cathelicidin‑LL37. Produced by solid‑phase peptide synthesis, supplied as white lyophilized powder with tested purity ≥98%.

In laboratory studies, LL37 is applied for in‑vitro and pre‑clinical experiments including microbial membrane interaction assay, inflammatory cell response mechanism, epithelial cell biological behavior, innate immunity‑related biological‑model research. This product is lab‑grade raw material only for biochemistry, molecular‑cell and pharmacology research projects.

Store unopened lyophilized powder at ‑20℃, keep dry and away from light. Reconstitute with 0.9% BAC bacteriostatic water. After reconstitution, store at 2‑8℃ refrigeration. Gently swirl the vial to dissolve powder, do not shake violently. Avoid high‑temperature environment to prevent peptide oxidation and deactivation.

Why choose us?
1.High quality products with competitive pricing.
2.Free samples available for your evaluation and testing.
3.Fast, reliable delivery via reputable shipping lines.
4.Trial orders are welcome for quality verification after sample approval.
5.Proactive updates and full transparency at every stage of your order.
6.Custom packaging solutions tailored to meet your specific requirements.

Item	Details
Product Name	LL37
Appearance	White Lyophilized Powder
Purity	≥99%
CAS No.	154947-66-7
Specification	10mg per vial
Storage (Unopened)	-20℃, Keep dry and away from light
Storage (After reconstitution)	2-8℃ refrigerated, use within 7-12 days
Solvent for reconstitution	BAC water (Benzyl Alcohol 0.9%)
Shelf life	24 months under proper storage

Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide 375-Detailed Image 1

Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide 375-Detailed Image 2

Shop Most-C Wholesale Peptide with Fast Global Shipping and Custom Packaging Hot sale-Detailed Image 3

Application

LL37 is widely used in academic laboratory research, including cell activity research, fibroblast related experiments, oxidative stress mechanism, inflammatory response study, tissue repair mechanism and pre-clinical biological model research.

FAQ

Q1: Can you provide COA for LL37?

A: Yes, official batch COA test report can be provided.

Q2: What solvent is suitable for reconstitution?

A: We recommend 0.9% BAC bacteriostatic water for best solubility and activity retention.

Q3: How long can reconstituted LL37 be stored?

A: 2-8℃ refrigerated storage, valid for 7-10 days after dissolving.

Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide 375-Detailed Image 4

Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide 375-Detailed Image 5

Shop Most-C Wholesale Peptide with Fast Global Shipping and Custom Packaging Hot sale-Detailed Image 5

Delivery&Shipment

Shop Most-C Wholesale Peptide with Fast Global Shipping and Custom Packaging Hot sale-Detailed Image 6

Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide 375-Detailed Image 8

Shop High-Purity Peptide Globally Best-Selling Good price fast delivery peptide Chemical peptide 375-Detailed Image 9 Shop Most-C Wholesale Peptide with Fast Global Shipping and Custom Packaging Hot sale-Detailed Image 7

Items

Specifications

Name

LL37

CAS

154947-66-7

Purity

Appearance

Heavy Metals

Residual TFA

Available Specification

99%

White lyophilized powder

＜10 ppm

≤0.5%

10mg per vial

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Polypeptide

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Manufactory

Main Products:
retatrutide,TB-500,GHK-CU,peptide

Location:
1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

Payment Terms:
TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Total Annual Revenue:
$10 million-$25 million

Total Employees:
501-1000

Year of Establishment:
2023

Pharma Grade Peptides is your premium source for high-quality purified research peptides.

We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

Over the course of many years, we have empowered researchers and scientists to
explore new avenues of scientific discovery.

Inquiry History

4 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026
United States	LL-37	10 MG	Oct 17, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
LL37 99% freeze dried powderLyophilized Powder 154947-66-7 peptides for sale	Pharmaceutical Grade/99	$12-15/UNIT FOB	Runlian peptide supplier	Inquiry
LL37 5mg	Pharmaceutical Grade/99	$80-85/UNIT FOB	Guangzhou Chengxin International Trade Co., Ltd.	Inquiry
Manufacturer's price TR60 2S10 BPC 10mg+GHK-Cu50mg+Tb 10mg G5K B12 2S50 Tesamorel	Cosmetics Grade/99	$1/G FOB	Chengtai Co., Ltd.	Inquiry
LL37, Research peptide, Lyophilized powder, Antimicrobial activity, Skin repair, Anti-inflammatory, Host defense peptide, Wound healing	Pharmaceutical Grade/99	$95/UNIT FOB	Beijing Novio Biotechnology Co., Ltd.	Inquiry
LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply	Research Grade/99	$90/UNIT FOB	Yiwu Nianwu	Inquiry

LL37 99% Freeze-dried powder 375 In stock Minimum Order| High quality

Product Description

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches

More from this Seller