 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > High purity LL37 cas154947-66-7 with good price

High purity LL37 cas154947-66-7 with good price buy - large image1

High purity LL37 cas154947-66-7 with good price buy - image1

High purity LL37 cas154947-66-7 with good price buy - image2

High purity LL37 cas154947-66-7 with good price buy - image3

High purity LL37 cas154947-66-7 with good price buy - image4

High purity LL37 cas154947-66-7 with good price

Name: High purity LL37 cas154947-66-7 with good price
Brand: COMINGS
SKU: pr2409191041
Price: 12.49 USD
Availability: InStock

TDS 4 Inquiries

Unit Price: Get Latest Price 

CAS No.:

154947-66-7

Grade:

Top Product

Content:

99%

Port:

shanghai

Brand:

COMINGS

Packaging:

1g,50g,100g,1000g

Price valid (until):

2025-05-14

Contact Supplier

 Chat Now

Wuhan Comings Biotechnology Co., Ltd.

Company Type:

Trader

Location:

China

Payment Terms:

TT against copy of documents,100% TT in advance

Average Lead Time:

15 days

Qualification:

Main Products:

semaglutide,tirzepatide,Liraglutide,Retatrutide,5-amino-1MQ,SLU-PP-332

 Visit Store

Product Details
Seller Information
Inquiry History

Description

cas	154947-66-7
Name	LL37
Synonyms	SUNTHEANINE THEANINE,L N5-ethyl-L-glutamine theanine L-TheaMine
MF	C205H340N60O53
Purity	99%
Application	Ll-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.

Wuhan Comings Biotechnology Co., Ltd. was established in 2016. Since its establishment, the company has always been committed to making more people healthy, making more people young and happy, and providing customers with high-quality and efficient services.

The company cooperates with biological experts from many universities, adopts modern gene cloning technology and unique purification technology, and strictly controls all aspects. The adipotide we produce are sold well in Europe, Africa, and America, and many customers have given good reviews.

And our company has storage bases in Shenzhen, Shanghai, Qingdao ports to ensure that all goods can arrive safely, on time and quickly.

Wuhan Comings Biotechnology Co., Ltd. is looking forward to cooperating with you with professional knowledge, high-quality service and competitive price!

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Bulk Drug Intermediates

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Trader

Main Products:
semaglutide,tirzepatide,Liraglutide,Retatrutide,5-amino-1MQ,SLU-PP-332

Location:
No. 1, 19th Floor, Unit 2, Building 5, Southeast Residential Building (Hankou Yujiang Lanting), at the intersection of Hanshi Highway and Fufa South Road, Wuhu Street, Huangpi District, Wuhan City, Hu

Payment Terms:
TT against copy of documents,100% TT in advance

Average lead Time:
15 days

Total Annual Revenue:
$1 million-$2.5 million

Total Employees:
11-50

Year of Establishment:
2023

We prospectively allocates international cutting-edge production and testing equipment and environmental protection facilities. The 5 production lines can achieve an annual output of 1000Kg. We to be the best chemical manufacture in China,and will become a trustworthy supplier of chemicals for global customers.
Our main products include peptides, cognitive enhancers, pharmaceutical intermediates, and botanical extracts.
And our main clients cover: pharmaceutical companies, hospitals, laboratories in higher education institutions, and cosmetic companies.
Since its establishment, our company's products have been exported to regions including Europe, the Americas, the Middle East and so on. Our commitment to high product quality and excellent after-sales service has provided customers with a positive experience.
Wuhan Comings Biotechnology Co., Ltd. is looking forward to cooperating with you with professional knowledge, high-quality service and competitive price!

Inquiry History

4 Inquiries

Country	Product	Purchase Quantity	Date Posted
United States	LL-37	10 MG	Oct 17, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
LL37 Peptide with High quality wholesales peptides 154947-66-7 with high quatity	Pharmaceutical Grade/99	$12-13/BOU FOB	Hangzhou Zhongshuan Technology Co., Ltd.	Inquiry
LL37 99% freeze dried powder	Pharmaceutical Grade/99.9	$10.31/MT FOB	Shandong Changxu Trade CO.,LTD	Inquiry
Factory Supply High Purity Peptide 99% Pure Ll37 CAS 154947-66-7 Ll-37 with best price	Cosmetics Grade/99.9	$21.63-25.76/G EXW	Tianjin DF Import & Export Co., LTD	Inquiry
Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research	Reagent Grade/99	$50/UNIT FOB	Yiwu Zhanpian Trading Co., Ltd.	Inquiry
LL37-5mg\|Factory Direct Supply\|>99% High Quality Peptide\|Fast and Safe Shipping\|Door-to-Door Delivery Service\|After-Sale Guarantee	Pharmaceutical Grade/99	$2/UNIT FOB	Tong peptides	Inquiry

High purity LL37 cas154947-66-7 with good price

Product Details

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches

More from this Seller