Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder 154947-66-7
LL37 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder 154947-66-7 buy - large image1
LL37 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder 154947-66-7 buy - image1
LL37 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder 154947-66-7 buy - image2
LL37 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder 154947-66-7 buy - image3
LL37 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder 154947-66-7 buy - image4
LL37 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder 154947-66-7 buy - image5
LL37 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder 154947-66-7 buy - image6

LL37 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder 154947-66-7

TDS

Unit Price:

$20-25/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GUANGZHOU

Brand:

APKX

Packaging:

5 mg/vial

Price valid (until):

2027-03-09

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Description




    Company Introduction

    Salesperson: Zory

    WhatsApp:+86 180 5357 9924 or +1 (608) 658-5770

    Email:sales04@cnspks.com

    We sincerely look forward to your inquiries about our products.

    Shop Top Quality Tirzepatide Powder Fitness and Weight Loss   2023788-19-2-Detailed Image 1 Shop Top Quality Tirzepatide Powder Fitness and Weight Loss   2023788-19-2-Detailed Image 2 Shop Top Quality Tirzepatide Powder Fitness and Weight Loss   2023788-19-2-Detailed Image 3


    Tianjin Apex Import and Export Trading Co., Ltd. is a professional manufacturer of various peptide products and chemical raw materials.
    We have a dedicated R&D team and a reliable, efficient logistics team to ensure you receive high-quality products safely and promptly. Our customers come from countries including the United States, Europe,
    Europe, Japan, South Korea, and India. Most of our main products are in stock and ready for immediate shipment. Please let us know the specific quantity you need, and we will offer you the most competitive price. Feel free to contact us for more information.nput...

    Shop Top Quality Tirzepatide Powder Fitness and Weight Loss   2023788-19-2-Detailed Image 4 Shop Top Quality Tirzepatide Powder Fitness and Weight Loss   2023788-19-2-Detailed Image 5

    • 1. LL37 has been used as an antimicrobial agent to improve wound healing.

      2. LL37 has been used as a vaccine adjuvant to enhance the immune response of vaccines.

      3. LL37 has been used as a therapeutic agent for the treatment of inflammatory diseases such as asthma and cystic fibrosis.

      4. LL37 has been used as an immunomodulator to modulate the immune response and enhance the production of pro-inflammatorycytokines and chemokines.

      5. LL37 has been studied as a potential target for cancer therapy, due to its ability to induce apoptosis and inhibit cancer cell growth.

      6. LL37 has been studied as a potential target for antiviral therapy due to its ability to inhibit the replication of viruses.


      Usage and dosage  

      Subcutaneous injection.

      The recommended starting dose is 2.5 mg subcutaneously once weekly, increasing to 5 mg after 4 weeks, and then in 2.5 mg increments based on treatment response and tolerance, up to a maximum dose of 15 mg subcutaneously once weekly.
      Can be taken at any time of day, with or without food, into the abdomen, thigh, or upper arm, rotating the injection site with each injection.


    Shop Top Quality Tirzepatide Powder Fitness and Weight Loss   2023788-19-2-Detailed Image 6


    Shop Top Quality Tirzepatide Powder Fitness and Weight Loss   2023788-19-2-Detailed Image 7









    Shop Top Quality Tirzepatide Powder Fitness and Weight Loss   2023788-19-2-Detailed Image 8


    Shop Top Quality Tirzepatide Powder Fitness and Weight Loss   2023788-19-2-Detailed Image 9 Shop Top Quality Tirzepatide Powder Fitness and Weight Loss   2023788-19-2-Detailed Image 10 Shop Top Quality Tirzepatide Powder Fitness and Weight Loss   2023788-19-2-Detailed Image 11 Shop Top Quality Tirzepatide Powder Fitness and Weight Loss   2023788-19-2-Detailed Image 12 Shop Top Quality Tirzepatide Powder Fitness and Weight Loss   2023788-19-2-Detailed Image 13 Shop Top Quality Tirzepatide Powder Fitness and Weight Loss   2023788-19-2-Detailed Image 14 Shop Top Quality Tirzepatide Powder Fitness and Weight Loss   2023788-19-2-Detailed Image 15 Shop Top Quality Tirzepatide Powder Fitness and Weight Loss   2023788-19-2-Detailed Image 16


    1. Customization & R&D Support

    We offer flexible custom synthesis services, supported by an experienced R&D team. Whether you’re looking for novel peptide sequences, cosmetic-grade purity, or modified molecules (e.g., PEGylation, acetylation), we can deliver high-quality results on time.

    Our services include:
    * Custom peptide synthesis (mg to kg scale)
    * Peptide modifications and labeling
    * Small molecule synthesis
    * Project-based research and scale-up

    We work closely with our clients to ensure technical feasibility, fast delivery, and cost control throughout the development cycle.

    2. Wide Product Portfolio

    We supply a comprehensive and expanding product range:
    * Peptides: GLP-1 analogs (e.g., Semaglutide, Tirzepatide, Retatrutide), cosmetic peptides (e.g., Acetyl Hexapeptide-8, Matrixyl), anti-aging peptides, research peptides.
    * Small Molecules: Nootropics, NAD+ boosters (e.g., NMN, NR, NADH), and intermediates.
    * Biochemicals: Amino acid derivatives, enzyme co-factors, custom reagents.

    New products are launched regularly to meet evolving market needs. We also support batch reservations for clients with ongoing or seasonal demand.
    3:FAQ

    Q1:Are you a supplier or a manufacturer?
    A:We are both a supplier and a manufacturer.

    Q2:How will you deliver the goods?
    A:We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS, China Air Post. For container products, we can do sea shipping. You also can choose your own shipping forwarder.

    Q3:Which kind of payment terms do you accept?
    A:, Bitcoin, PayPal.USDT.

    Q4:How is the after-sales service?
    A:We will provide high-quality products and ensure 100% safe deliver.

    Q5:how can we guarantee quality?
    A:We will send you a COA (Certificate of Analysis) to you first for you to confirm the quality.

    Q6: How to confirm the Product Quality before placing orders?
    A:You can get free samples for some products, you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.

    Q7:Is there any discount?
    A:Yes, for larger quantity, we always support with better price
    Items Specifications
    Purity 99%
    Appearance powder
    Storage Store at -20°C
    Delivery Time
    3-5days

    Certificates
    • LL37 | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder 154947-66-7 Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    Room 3043, 3rd Floor, Building 15, No. 185 Xinda Road, Wanghailou Street, Hebei District, Tianjin

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    11-50

    Year of Establishment:

    2025

    Certifications:

    .,证书


       公司简介  


    Company Profile
    We are a modern, rapidly growing biopharmaceutical company specializing in the production of pharmaceuticals, biologics, and nutraceuticals. We offer internationally leading healthcare products, chemicals, electronics, and mining machinery. Our innovative, full-cycle production facilities fully comply with GMP and ISO standards. We are committed to providing high-quality, affordable, innovative products to prevent disease and support healthier lifestyles. We optimize scientific innovation and production technologies to enable our customers to better serve their consumers. We provide a comprehensive range of services and products for the pharmaceutical and nutraceutical industries, from custom development and production of active ingredients to finished dosage forms. With our scale and resources, we offer our customers one-stop solutions to help people get, feel, and stay well.
    
  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.