Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > In stock Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37
In stock Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37 buy - large image1
In stock Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37 buy - image1
In stock Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37 buy - image2
In stock Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37 buy - image3
In stock Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37 buy - image4
In stock Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37 buy - image5
In stock Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37 buy - image6

In stock Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37

TDS 1 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Cosmetics Grade

Content:

99.9%

Port:

shenzhen

Brand:

Runlian or as clients' requirement

Packaging:

1g,10g,100g,1kg,10ml,15ml,20ml,30ml or as clients' requirement

Price valid (until):

2026-01-22

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide,retatrutide,Semaglutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

                                                                                                                                                                                                                                                                                                                                                                                Yori                                                                                                                                                                                                                       

    whatsapp:+86 15176122850
    Email:yori@hnrunlian.com

    Use this screenshot to add me and you'll get a surprise!  

      Welcome to contact me!




    Shop In stock Cosmetic Grade Copper Peptide Powder Ghk-Cu with Best Price and High Quality Ruilian-Detailed Image 1 Shop In store CAS 910463-68-2 Semaglutide Peptides Weight Loss Supplement Slimming Products for Healthy-Detailed Image 2 Shop In stock GHK-CU 89030-95-5 Copper tripeptide Door-to-door delivery, spot, high quality, high purity, free shipping-Detailed Image 3 Shop In stock GHK-CU 89030-95-5 Copper tripeptide Door-to-door delivery, spot, high quality, high purity, free shipping-Detailed Image 4

    Product details 

    Products Name: LL-37
    Chemical Name: LL-37 Antibacterial Protein
    CAS No: 597562-32-8
    Molecular Formula: C205H341N61O52
    Molecular Weight: 4492.28g/mol
    Purity: >98.0%
    Application: Antibacterial peptide
    Appearance: White Lyophilized powder
    Reconstitution: Required
    Storage: After reconstitution store at 2°C - 8°C

    LL-37 is the only known human Cathelicidin is a big protein family where the members exhibit diverse functions. These peptides, essentially produced by macrophages and polymorphonuclear leukocytes (both types of white blood cells), have bactericidal action. They have been found to have shown other substantial effects as well. The entire group is often referred to as antimicrobial peptides (AMPs). LL-37 in particular has been found to play significant roles in autoimmune disease, cancer, and wound healing


    Items Specifications
    Product  Name Copper Peptide
    Purity >99.0%
    Appearance White Lyophilized powder or others
    Reconstitution Required
    Storage After reconstitution store at 2°C - 8°C, well-closed containers
    MOQ 1 box
    Package 10 vials per box
    Payment term Alipay,Bitcoin,USDT,T/T, WU
    Delivery time Within 3 Working Days Payment
    Advantage Door to door,Clearance,100% safe delivery to your hands,By air receive them about 5-10days

    Shop In stock GHK-CU 89030-95-5 Copper tripeptide Door-to-door delivery, spot, high quality, high purity, free shipping-Detailed Image 5 Shop In stock GHK-CU 89030-95-5 Copper tripeptide Door-to-door delivery, spot, high quality, high purity, free shipping-Detailed Image 6 Shop In stock Cosmetic Grade Copper Peptide Powder Ghk-Cu with Best Price and High Quality Ruilian-Detailed Image 7

    Shipping and packages

    Shop In stock GHK-CU 89030-95-5 Copper tripeptide Door-to-door delivery, spot, high quality, high purity, free shipping-Detailed Image 8 Shop Cheapest price MT-1 Super Quality 75921-69-6 Manufacturer sell effective powder peptide in stock-Detailed Image 9 Shop In stock GHK-CU 89030-95-5 Copper tripeptide Door-to-door delivery, spot, high quality, high purity, free shipping-Detailed Image 10 Shop In stock GHK-CU 89030-95-5 Copper tripeptide Door-to-door delivery, spot, high quality, high purity, free shipping-Detailed Image 11

    Shop In stock GHK-CU 89030-95-5 Copper tripeptide Door-to-door delivery, spot, high quality, high purity, free shipping-Detailed Image 12

    Shop In stock GHK-CU 89030-95-5 Copper tripeptide Door-to-door delivery, spot, high quality, high purity, free shipping-Detailed Image 13



    Goods quality:
    1.Product has COA, and HPLC testing report
    2.Our factory is ISO9001 standard
    3.We have the great reviews from customers

    OEM service:
    1.Customized logo
    2.Customized label, packing box as customer's requirement
    3.Cap color can be customized

    Shipping service:
    1.Goods shipped in 1-3 days after payment.
    2.Shipping fast and safe in about 5-10 days
    3.We can do special packing
    4.Tracking number is offered after ordering
    Door to door,Clearance,100% safe delivery to your hands
    If there is any problem in transportation, we are willing to bear all costs,
    FAQ
    Q: How to order this product?
    A:You can send us your Purchase order(if your company has), or just send a simple confirmation by email or message, we will send you order confirmation, then you can make your order accordingly.
    Q: How long can I receive my ordered goods?
    A: We ship by special line shipping door to door; you can receive it in about 8-15 days.
    Q: What's your MOQ?
    A:For the regular products, our MOQ is 1box; For other customized products, our MOQ starts from 10boxes to 50boxes.
    Q: Is there a discount?
    A: Yes, for larger quantity order, we always support with better price.
    Q: How to store it?
    A: If it hasn't been opened, just put it in cool dry place, if it is opened, you may put it in cold storage for 2-5 degree condition.
    Q: Are you manufacturer or trading company?
    A: We are manufacturer for over 8 years now, peptides are our main product, and we also develop others, such as raw powders, nootropics, plant extracts, etc.
    Packaging Process
    Shop In stock Bodybuilding peptide Oxytocin Acetate Factory direct sale High quality CAS 6233-83-6 Custom Peptide-Detailed Image 14



    Shop In store CAS 910463-68-2 Semaglutide Peptides Weight Loss Supplement Slimming Products for Healthy-Detailed Image 15
    Delivery Record:
    Shop In store CAS 910463-68-2 Semaglutide Peptides Weight Loss Supplement Slimming Products for Healthy-Detailed Image 16 Shop In store CAS 910463-68-2 Semaglutide Peptides Weight Loss Supplement Slimming Products for Healthy-Detailed Image 17
    Company Profile
    Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.
    Customer feedback
    Shop In store CAS 910463-68-2 Semaglutide Peptides Weight Loss Supplement Slimming Products for Healthy-Detailed Image 18
    Shop In store CAS 910463-68-2 Semaglutide Peptides Weight Loss Supplement Slimming Products for Healthy-Detailed Image 19

    Certificates
    • In stock Medicine Grade Peptide ll37 Powder 5mg 10mg 15mg LL37 CAS 154947-66-7 LL-37 Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide,retatrutide,Semaglutide

    Location:

    Room 2008, 20th Floor, Unit 2, Building 15, No. 152, Dongsanmalu, Guancheng Hui District, Zhengzhou City, Henan Province

    Average lead Time:

    15

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    11-50

    Year of Establishment:

    2024


      Company Profile  


    About Us
    We have been a professional peptide product manufacturer and have overseas warehouses in the United States, Canada and Australia, which are shipped on the same day. Our products are exported to the United States, Canada, Mexico, Australia, the Netherlands, Germany, and other countries. Equipped with state-of-the-art laboratory facilities and cutting-edge production technologies, we uphold the principle of "Quality Primacy" and the philosophy of "Customer Sovereignty" in developing superior biological solutions.

    OEM/ODM Services Available
    Our core competitiveness is rooted in a production system certified by both GMP and ISO. We ensure that our products meet international standards through full-process quality control management. Moreover, by relying on our scientific research and development system, we achieve optimal efficiency in production output. In response to the demands of brand customers, we have specially developed tailored production solutions. Through the OEM/ODM service model, we provide personalized product development plans for our brand enterprises.

    Service Assurance Protocol
    We pledge to ensure the secure transit of client consignments with guaranteed delivery precision. Should any shipment discrepancy occur, our comprehensive compensation policy ensures 100% value reimbursement, coupled with expedited replacement arrangements within 8 business hours.

    Win-win Cooperation
    We cordially invite global partners to witness firsthand how biotechnology is revolutionizing the beauty and wellness industries. At RUNLIAN, every molecular formula embodies the ingenuity of intelligent manufacturing, and every collaboration initiates a new chapter of mutual success. As our founder emphasizes, "We bridge dreams with reality through science, demonstrating China's biotechnological prowess to the world."

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.