weight loss products, factory wholesale prices. We are a factory. High-quality products.

Name :Kate

Whatsapp/wechat:+86 18562300759

Email:zwxs2@zwxstech.com

What is LL 37 peptide ?

•  

  LL 37 peptide, also known as CAP-18 for Cathelicidin antimicrobial peptide 18, is a 37 amino acid cationic peptide.LL 37 is also a typical linear antimicrobial peptide which can eliminate a wide range of pathogenes, including bacteria, viruses, fungi, and parasites. CAP-18 is the only human cathelicidin peptide reported yet, found in lysosomes of macrophages and leukocytes

  Antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. Also triggers apoptosis in colon cancer cells. Cell permeable.

  
  

  The human body mainly produces two types of antimicrobial peptides: defensin family peptides and cathelicidin family peptides. Although there are many members of the defensin family of peptides, cathelicidin has only one antimicrobial peptide product, LL-37. LL-37 is the C-terminal cleavage product of cathelicidin peptide Hcap-18, which directly kills bacteria, fungi and viruses.

  
  

  	Sequence : LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  	MW : 4 493.4 Da (C205H340N60O53)
  	Purity : > 99%
  	Other names : Cathelicidin,154947-66-7, All38 peptide, BAC4, CAP18, CAMP,
  	Peptide Solubility Guideline
  	Bulk peptide quantities available

  
  

  What is the Benefit of LI 37 Peptide?

  1. Immune Support
  2. Antimicrobial Properties
  3. Wound Healing
  4. Anti-inflammatory Effects
  5. Angiogenesis Promotion 
  6. Anti-tumor Potential
  7. Skin Health
  8. Neuroprotective Effect

  
  

• Product Name	LL 37 peptide
  CAS number	 154947-66-7
  Other name	Alpha-Msh (11-13) Acetate
  Storage	Store at a temperature of 2-8 degrees, protected from light.
  Appearance	White  p owder

• 
  

Our customers are all over the world, mainly selling in the United States, Canada, Australia, the United. Kingdom, the Ne  therlands, Germany, France and other EU countries, Southeast Asia, South America, and Oceania. We also have many customers.
 Our business is based on honesty and mutual trust. Sincerely look forward to establishing long-term mutually beneficial business relationships with customers around the world.