Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37| China Warehouse|Cosmetic Peptide | 99% Purity | 5 mg 10 mg vial | Lyophilized Powder
LL37| China  Warehouse|Cosmetic Peptide  | 99% Purity | 5 mg 10 mg vial | Lyophilized Powder buy - large image1
LL37| China  Warehouse|Cosmetic Peptide  | 99% Purity | 5 mg 10 mg vial | Lyophilized Powder buy - image1
LL37| China  Warehouse|Cosmetic Peptide  | 99% Purity | 5 mg 10 mg vial | Lyophilized Powder buy - image2
LL37| China  Warehouse|Cosmetic Peptide  | 99% Purity | 5 mg 10 mg vial | Lyophilized Powder buy - image3
LL37| China  Warehouse|Cosmetic Peptide  | 99% Purity | 5 mg 10 mg vial | Lyophilized Powder buy - image4
LL37| China  Warehouse|Cosmetic Peptide  | 99% Purity | 5 mg 10 mg vial | Lyophilized Powder buy - image5
LL37| China  Warehouse|Cosmetic Peptide  | 99% Purity | 5 mg 10 mg vial | Lyophilized Powder buy - image6

LL37| China Warehouse|Cosmetic Peptide | 99% Purity | 5 mg 10 mg vial | Lyophilized Powder

1 Inquiries

Unit Price:

$55-60/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Hongkong

Brand:

Huitu

Packaging:

5 mg/vial

Price valid (until):

2026-07-05

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides,Retatrutide,GHK-CU

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    LL37

    xinaWhatsApp:+852 91635867

    Shop LL37| China  Warehouse|Cosmetic Peptide  | 99% Purity | 5 mg 10 mg vial | Lyophilized Powder-Detailed Image 1


    Company Profile


    Shop LL37| China  Warehouse|Cosmetic Peptide  | 99% Purity | 5 mg 10 mg vial | Lyophilized Powder-Detailed Image 2 Shop LL37| China  Warehouse|Cosmetic Peptide  | 99% Purity | 5 mg 10 mg vial | Lyophilized Powder-Detailed Image 3 Shop LL37| China  Warehouse|Cosmetic Peptide  | 99% Purity | 5 mg 10 mg vial | Lyophilized Powder-Detailed Image 4

    We specialize in supplying high-quality peptides directly from the manufacturer, offering a wide variety of peptides to meet different research needs. We provide customers worldwide with reliable products, competitive pricing, and stable inventory support. With advanced production systems and strict quality control procedures, all products are manufactured under high-standard conditions, with purity levels reaching up to 99%, ensuring consistency and reliability for research purposes.

    We maintain a stable inventory system, and most products are available in stock for immediate shipment. This allows us to provide fast order processing and efficient worldwide delivery. No matter where our customers are located, we are committed to offering safe, secure, and timely shipping services. Every order is professionally packaged to ensure product safety during transportation.

    To meet the diverse needs of customers worldwide, we support multiple flexible payment methods and provide professional, responsive customer service. From product inquiries and order processing to after-sales support, we focus on efficient communication and quick response to ensure a smooth cooperation experience.

    With years of industry experience, we have established long-term partnerships with customers from many countries and regions. We always regard product quality as our top priority and customer satisfaction as our core mission. By continuously optimizing our supply chain and service system, we strive to provide more professional and dependable support to our partners.

    Whether you require small quantities for research and testing or large-volume orders for long-term cooperation, we are committed to providing stable supply, reasonable pricing, a wide variety of peptides, trusted quality, and reliable service. Moving forward, we will continue to uphold the principles of "Quality First, Honest Cooperation, and Long-Term Win-Win Partnership” to grow together with customers worldwide.


    FAQ


               1.Are you a factory or trading company?
    We are a company integrating manufacturer and trading company

           2.What products do you have?
    We supplies Nootropic ingredients powder, Peptides (Such as Cosmetic peptide, Recombinant protein, Peptide intermediates,ect.),

    pharmaceutical intermediates (Such as Men's health ingredients, Cosmetic ingredients, Hair care Ingredients,

    Weight loss ingredients, Anti-cancer ingredients, Painkiller ingredients, etc.),

    Health supplements ( Such as Food additives, Vitamins, Amino acid, Enzyme,ect.), Plant extracts

          3.How is the quality I want to test.
    Before production and extraction, we will test all raw materials.Quality is our top priority.

    All products are strictly tested and confirmed by our QC and QA, approved by Third Party Lab in China.

    So you will be assured with Good Quality if you choose us. We welcome you test the product and hope to get your feedback.

          4. What's your main payment method?
    T/T (Bank transfer), Wu, Alipay,Credit card payment.

          5: How to proceed order?
    Please Let me konw the product you are looking for,quantity and the destination country wihch help me to give you a right price;

    After you confirm all details of order, pay money in advance and give us Shipping address.

    We arrange the shipment at first time after receive payment and offer after-sales service after you receive parcel.

          6.When will I receive the shipping number Where I can check status of my order?

    After the goods are sent out, our staff will send you the shipping number via email, online or WhatsApp ASAP.

    You can also check the status online on 17track.Shop LL37| China  Warehouse|Cosmetic Peptide  | 99% Purity | 5 mg 10 mg vial | Lyophilized Powder-Detailed Image 5 Shop LL37| China  Warehouse|Cosmetic Peptide  | 99% Purity | 5 mg 10 mg vial | Lyophilized Powder-Detailed Image 6 Shop LL37| China  Warehouse|Cosmetic Peptide  | 99% Purity | 5 mg 10 mg vial | Lyophilized Powder-Detailed Image 7

     

     

    Items Specifications
    375
    5 mg/vial
    375 10mg/vial


    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides,Retatrutide,GHK-CU

    Location:

    Room 503, 5th Floor, Office Unit 501, New Triumphal Arch Health Products Mall, Changzheng Road, Chengguan Town, Taihe County, Fuyang City, Anhui Province

    Payment Terms:

    TT against copy of documents,D/P,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    3

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    51-100

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.