Product
Supplier
Encyclopedia
Inquiry
LL37/ buy - large image1
LL37/ buy - image1
LL37/ buy - image2
LL37/ buy - image3

LL37/

1 Inquiries

Unit Price:

$90-100/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

上海

Brand:

JL

Packaging:

5mg*l0vials

Price valid (until):

2027-07-16

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Description

    These products are APIs (Active Pharmaceutical Ingredient) and not a finished drug. 

    It is intended strictly for research and laboratory use only.

    Buyers are required to fully comply with all applicable laws and regulations regarding the handling and use of this material.



      Advantage Shop LL37/-Detailed Image 1 Shop LL37/-Detailed Image 2


    1. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.


    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.



      ManufacturinShop LL37/-Detailed Image 3


    1. Expertise in Peptide Synthesis

    Extensive Experience: 7 Years of expertise in synthetic peptide development.

    Skilled Team: Experts in solid-phase and liquid-phase synthesis.


    2. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.


    3. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.


      Global Service  


    Who We Serve

    -We proudly work with clients across North America, Europe, Asia, and Latin America, including:

    -Biotech and pharma firms

    -Research institutions & universities

    -Peptide formulation startups

    -CDMOs and CRO partners


    Shop LL37/-Detailed Image 4

    Our products are widely used in life science research, drug discovery, cosmetics, anti-aging medicine, and functional health industries.


    1. Superior Product Quality

    Product quality is the foundation of our business.  Peptides are synthesized using solid-phase peptide synthesis (SPPS), then purified through HPLC and confirmed by mass spectrometry (MS).

    Each batch includes a Certificate of Analysis (COA) with key data:
    • Purity (HPLC)
    • Molecular weight (MS)
    • Water content
    • Residual solvents
    • Microbial limit (if applicable)

    For clients with higher regulatory demands, we also provide third-party testing reports, endotoxin (LAL) data, and stability studies upon request.


    2. Customization & R&D Support

    We offer flexible custom synthesis services, supported by an experienced R&D team. Whether you’re looking for novel peptide sequences, cosmetic-grade purity, or modified molecules (e.g., PEGylation, acetylation), we can deliver high-quality results on time.

    Our services include:
    • Custom peptide synthesis (mg to kg scale)
    • Peptide modifications and labeling
    • Small molecule synthesis
    • Project-based research and scale-up

    We work closely with our clients to ensure technical feasibility, fast delivery, and cost control throughout the development cycle.


    3. Wide Product Portfolio

    We supply a comprehensive and expanding product range:
    • Peptides: GLP-1 analogs (e.g., Semaglutide, Tirzepatide, Retatrutide), cosmetic peptides (e.g., Acetyl Hexapeptide-8, Matrixyl), anti-aging peptides, research peptides.
    • Small Molecules: Nootropics, NAD+ boosters (e.g., NMN, NR, NADH), and intermediates.
    • Biochemicals: Amino acid derivatives, enzyme co-factors, custom reagents.

    New products are launched regularly to meet evolving market needs. We also support batch reservations for clients with ongoing or seasonal demand.

    Items Specifications
    vial

    mg

    tude g
    bag kg

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide

    Location:

    zhejiangshengjinhuashiyiwushijiangdongjiedaodongnanlu656hao

    Average lead Time:

    15

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    Jielu Trading focuses on the global cross‑border supply chain of high‑end peptide raw materials. Rooted in cutting‑edge biotechnology, we specialize in the selection, quality control, trade and globalized services of peptide products.

    Adhering to strict quality standards and raw material traceability systems, we provide high‑purity and stable peptide raw materials as well as integrated supply‑chain solutions for scientific research, health care and medical aesthetics industries with standardized production and complete compliance qualifications.

    Guided by our brand philosophy With Peptide Power, Integrity Leads Far, Empowering the World, Jielu builds a stable and efficient global trade network with craftsmanship, integrity and global vision. We strive to be an influential benchmark service provider in the worldwide peptide industry, and create a brighter future with global partners.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.