 Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > weight loss products, factory wholesale prices. We are a factory. High-quality products

weight loss products, factory wholesale prices. We are a factory. High-quality products buy - large image1

weight loss products, factory wholesale prices. We are a factory. High-quality products buy - image1

weight loss products, factory wholesale prices. We are a factory. High-quality products buy - image2

weight loss products, factory wholesale prices. We are a factory. High-quality products buy - image3

weight loss products, factory wholesale prices. We are a factory. High-quality products buy - image4

weight loss products, factory wholesale prices. We are a factory. High-quality products

TDS 4 Inquiries

Unit Price:

$20-25/G FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Research Grade

Content:

99.9%

Port:

guangzhou

Brand:

Packaging:

5mg/vial

Sample Available:

Yes

Price valid (until):

2027-02-11

Contact Supplier

 Chat Now

Tianjin Huifeng Technology Co., Ltd.

Company Type:

Trader

Location:

China

Qualification:

Main Products:

peptides

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Detail

Sales Manager: Mily

WhatsApp: +86 19943528714
+852 98534126

Email: sales04@yw-jl.c

Items Specifications

CAS 154947-66-7

Appearance White Powder

Purity (HPLC) 99.9%

Q1: Are you a supplier or a manufacturer?
A: We are both a supplier and a manufacturer.
Q2: How do you make the delivery?
A: We have established stable cooperative relationships with DHL, TNT, UPS, FedEx, EMS, China Post Air Express, etc. For container transportation, we can arrange for sea shipping; you can also choose your own freight forwarder.
Q3: What payment methods do you accept?
A: We accept Alipay Bank Account USDT.
Q4: How about the after-sales service?
A: We offer high-quality products and guarantee 100% safe delivery.
Q5: How do you ensure product quality?
A: We will send you the analysis report (COA) of the sample to confirm the quality.
Q6: How can we verify the quality of the products before placing an order?
A: For some products, free samples are available. You only need to bear the shipping cost or arrange for a courier to pick them up. You can also provide the product specifications and requirements, and we will produce them accordingly.
Q7: Are there any discount offers?
A: Yes, the larger the order quantity, the more favorable the price will be.

Company Profile

Tianjin Huifeng Technology Co., Ltd. is a company specializing in the production of various peptide products and chemical raw materials. We have a professional R&D team and an efficient and reliable logistics team to ensure that you can receive high-quality products safely and on time. Our customers are located in the United States, Europe, Japan, South Korea, India, and other regions. Most of our main products are in stock and can be shipped immediately. Please inform us of your specific quantity requirements, and we will provide you with the most competitive prices. Welcome to contact us at any time for more information.
We offer a wide range of peptide products, which are widely used in life science research, drug development, cosmetics, anti-aging medicine, and functional health supplements. We guarantee excellent product quality and competitive prices. Customers who have ordered our peptide products have always given high evaluations. We sincerely welcome reliable buyers from all over the world to contact us and negotiate business cooperation for peptide products.

1. Outstanding Product Quality
Product quality is the foundation of our business. Our peptide compounds are synthesized using the solid-phase peptide synthesis method (SPPS), purified by high-performance liquid chromatography (HPLC), and verified by mass spectrometry (MS).
Each batch of products comes with an analysis certificate (COA), which contains key data: ••• Purity (HPLC) • Molecular weight (MS) • • • Moisture content • • • Residual solvents • • Microbial limits (if applicable).
For customers with stricter regulatory requirements, we can also provide third-party testing reports, endotoxin (LAL) data, and stability study documents.
2. Customized Services and R&D Support
We provide flexible customized synthesis services and support from an experienced R&D team. Whether you need a new peptide sequence, cosmetic-grade purity, or modified molecules (such as PEGylation or acetylation), we can deliver high-quality products on time. Our services include:
•• Custom peptide synthesis (milligram to kilogram level)
••• Peptide modification and labeling
•• Small molecule synthesis
• Project-based R&D and large-scale production
We work closely with our clients to ensure technical feasibility, rapid delivery, and cost control throughout the entire development cycle.
3. Diverse product portfolio
We offer a wide range of products that are continuously expanding:
••• Peptides: GLP-1 analogues (such as sitagliptin, tazapetide, retactide, etc.), cosmetic-grade peptides (such as acetyl hexapeptide-8, Matrixyl, etc.), anti-aging peptides, and research-grade peptides.
•• Small molecule compounds: Cognitive enhancers, NAD+ precursors/promoters (such as NMN, NR, NADH) and intermediates.
• Biochemical products: Amino acid derivatives, enzyme cofactors, and custom reagents.
To meet the constantly changing market demands, we regularly introduce new products. At the same time, we also provide batch pre-order services for customers with continuous or seasonal demands.

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Certificates
- TDS
Basic Info

Product Name:
LL-37

Other Name:
Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:
154947-66-7

Molecular Formula:
C205H340N60O53

InChIKeys:
POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:
0

EC Number:
211-519-9

Color/Form:
White to off-white

Categories:
Polypeptide

Characteristics

Water Solubility:
Soluble to 1 mg/ml in water
Seller Information

Business Type:
Trader

Main Products:
peptides

Location:
No. 85, Qingnian Road, Hongqiao District, Tianjin

Total Annual Revenue:
$5 million-$10 million

Total Employees:
51-100

Year of Establishment:
2026

Inquiry History

4 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
United States	LL-37	10 MG	Oct 17, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Factory supply LL-37 peptide raw powder high purity bulk wholesale supply	Pharmaceutical Grade/99	$50/MT FOB	Guangzhou Anymang Technology Co., Ltd.	Inquiry
LL37 LL-37 CAS 154947-66-7 99% Purity Peptide Lyophilized Powder Factory Supply	Research Grade/99	$90/UNIT FOB	Yiwu Nianwu	Inquiry
Quick inventory delivery VIP5 PNC27 MT1 KPV5 AA10 SHB XA10	Cosmetics Grade/99	$1/G FOB	Chengtai Co., Ltd.	Inquiry
LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support	Pharmaceutical Grade/99	$50-60/UNIT FOB	Hainan Terte New Materials Co., Ltd.	Inquiry
Biochemical Intermediate LL37 Polypeptide Custom Vial Specifications For Immune Cell Mechanism Research	Reagent Grade/99	$50/UNIT FOB	Yiwu Zhanpian Trading Co., Ltd.	Inquiry

weight loss products, factory wholesale prices. We are a factory. High-quality products

Product Description

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches

More from this Seller