 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale

Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale buy - large image1

Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale buy - image1

Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale buy - image2

Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale buy - image3

Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale buy - image4

Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale

Name: Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale
Brand: YiXin
SKU: pr2607163918
Price: 70 USD
Availability: InStock

TDS 3 Inquiries

Unit Price:

$70/UNIT FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Reagent Grade

Content:

99.9%

Port:

China

Brand:

YiXin

Packaging:

10vials/box 5mg*10vials

Price valid (until):

2030-12-31

Contact Supplier

 Chat Now

Yixin Biotechnology Co., Ltd.

Company Type:

Trader

Location:

China

Payment Terms:

TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

Average Lead Time:

7 days

Qualification:

Main Products:

polypeptide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Detailed Product Description

NAME:Amelia
WHATSAPP:+852-70187112
EMAIL:meng@yxtrading.cn
Welcome to concult
Haupteigenschaften

Branchenspezifische

CAS-Nr.	\
Reinheit	99.9%

Weitere

Place of Origin	Shandong, China
Consumption	Cosmetic raw materials
Appearance	White powder
Brand	yixin
Brand name	Avoid direct sunlight in a cool and dry place.
Shelf life	2 years
MOQ	1 milligram
Packaging	plastic bottle
Sample	Available
EINECS No.	\

Peptide Product Description

Small-molecule peptides penetrate deeply, repair and nourish for firm, supple state.

These products are APIs (Active Pharmaceutical Ingredient) and not a finished drug.

It is intended strictly for research and laboratory use only.

Buyers are required to fully comply with all applicable laws and regulations regarding the handling and use of this material.

product details

Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 1

Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 2

Company Profile

Our company has a complete range of building and decoration chemical materials, and the factory takes product quality as its goal. The company adheres to the principles of integrity, quality first, active development, and quality service, serves customers with a professional and responsible spirit, and continuously improves and innovates to meet customer needs. The quality goal is to achieve zero defects and zero complaints, and serve customers with a professional and responsible spirit

Shop High Purity Tirzepatide Peptide Powder For Research Weight Loss CAS 2023788-19-2-Detailed Image 3

Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 6

our services

1. We supply Peptides, APIs & Intermediates and so on to satisfy your needs;
2. We will reply you for your inquiry in 24 hours;
3. Strictly on selecting raw materials . Our Q&C team will inspect every product quality strictly before delivery;

4. Reasonable & competitive price, fast lead time ;

5. After delivery, we will track the products for you once every two days, until you get the products. When you got the goods, if you have any questions about the problem, contact with us, we will offer the solve way for you ;

6. 100% safe delivery, guaranteed delivery .

payment method

Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 9

Our Advantages

1. We have long-term cooperation with the Europe&North America&South America&Middle East&Asia export.

2. There are long-term and stable transportation companies in transportation, which can ensure 100% delivery of goods.

3. We can customize and develop various corresponding products according to the special requirements of customers, and provide customers with strong technical support and a complete set of industry solutions.

4. We provide the best private label OEM and ODM services to meet different customers. Feel free to contact us!

Product Packaging

Shop High Purity Tirzepatide Peptide Powder For Research Weight Loss CAS 2023788-19-2-Detailed Image 4

Shop High Purity Tirzepatide Peptide Powder For Research Weight Loss CAS 2023788-19-2-Detailed Image 5

Shop High Purity Tirzepatide Peptide Powder For Research Weight Loss CAS 2023788-19-2-Detailed Image 6

Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 13

Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 14

Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 15

Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 16

1. Ultra-High Purity

Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

2.Accurate Dosing & Consistency
Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

3.Endotoxin-Free & Sterile Processing
Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

mode of transportation

Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 20

Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 23 .

Q: How to store it?

A: If it hasn't been opened, just put it in cool dry place, if it is opened, you may put it in cold storage for 2-5 degree condition.

Q: How to order this product?

A: You can click "contact Supplier" , or write an email to my inbox, and send us a inquiry, leave your number if possible, we will contact with you as soon as possible, then we can talk order details.

Q: How about the delivery time?

A: Shipped within 48 hours after payment is received.Small orders are shipped via express door-to-door.The goods arrive in about7-10 days.

Q ： ls cash on delivery ?

A:in most cases,we don't support cash on delivery.

Q: How much is the commodity?

A: As we all know, the price of chemicals is not fixed, but fluctuates with the market.

You need to contact me to get the latest product price, we promise to give you the most favorable price.

Q:About the after-sale service?

A:After purchasing the products from our Company, we have a professional technical team and after-sales team to serve you and solve all your problems in the future.

Company Profile

We have many years of trading experience and are professional Chemical raw materials, medicine, Pharmaceutical raw material suppliers in overseas . Hope to cooperate with you for a long time and achieve win-win purpose. Our experienced staff is committed to strict quality control and attentive customer service and is always available to discuss your requirements and ensure complete customer satisfaction. Our company firmly believes that all products must comply with international quality standards. We therefore focus on sourcing quality materials and ensuring strict internal process controls. Our professional inspectors ensure that the products delivered to our customers are perfect. Our company adhere to the "customer first, reputation assurance, quality assurance, professional service" policy. No matter what type of product you need, you can contact us at any time, we will provide high quality products in the fastest and best way to achieve customer satisfaction. In addition, we will provide the best service to our customers. We look forward to establishing long-term business relations with overseas on the basis of mutual benefit in the near future. If you are interested in our products or companies, please feel free to contact us for more details!
Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 26

Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 26

Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 27

Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 28

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Research & Reference Note

Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Authoritative sources

Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Bulk Drug Intermediates

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Trader

Main Products:
polypeptide

Location:
No. 4, 4th Floor, Building D1, Bili La Park, Lu Shang Road, Dongcheng Street, Economic and Technological Development Zone, Liaocheng City, Shandong Province

Payment Terms:
TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

Average lead Time:
7 days

Total Annual Revenue:
$10 million-$25 million

Total Employees:
101-200

Year of Establishment:
2025

Company Certificates
- Tirzepatide
- Tirzepatide
15 Years of Industry Experience
We have been a high-tech company focused on the development, production, and marketing of various peptide products for 15 years. Through advanced laboratories and strict quality control, our internationally certified products are safe and effective.

Clients in Europe, the USA, Southeast Asia, the Middle East
As a global trading company, we serve clients in Europe, the USA, Southeast Asia, the Middle East, and beyond and provide customized solutions. Committed to "technology leading Health", we aim to innovate and deliver high-quality health products worldwide.

3,000-square-meter Factory with 60 Employees
We have a factory covering 3,000 square meters and housing 60 employees to guarantee the highest quality all the time. We hired three quality auditors with three years of experience. They meticulously inspect each item at every production stage.

Contact Us Now
Our products are exported to more than 130 countries and regions, which can be delivered fast within 5-14 days. We can provide OEM/ODM support to our customers. We have 10 professional after-sales staff to make 24-hour responses to our customers. Contact us now to learn more.

Inquiry History

3 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
TR30 TR40 TR50 TR60 RT5 RT10 RT15 RT20 RT30 CAS2381089-83-2	Pharmaceutical Grade/99	$1/G FOB	Chengtai Co., Ltd.	Inquiry
RT \| TongPeptides \| 99.9% Purity \|COA ,.,	Pharmaceutical Grade/99.5	$3/UNIT FOB	Tong peptides	Inquiry
LL37 Fast delivery High purity Weight loss peptide Safe transportation	Pharmaceutical Grade/99	$20-25/G FOB	Shanxi Andashihai Technology Co., Ltd.	Inquiry
LL37 99% freeze dried powderLyophilized Powder 154947-66-7 peptides for sale	Pharmaceutical Grade/99	$12-15/UNIT FOB	Runlian peptide supplier	Inquiry
Factory Wholesale Price Hot sale LL-37 99% white powder peptide Weight Lose	Pharmaceutical Grade/99	$100/MT FOB	Hangzhou Zhongma Peptide	Inquiry

Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale

Product Description

Seller Information

Inquiry History

NAME:Amelia
WHATSAPP:+852-70187112
EMAIL:meng@yxtrading.cn
Welcome to concult
Haupteigenschaften

Branchenspezifische

Weitere

More Choices Find All Products for Sale 

Related Searches

More from this Seller

Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale

Product Description

Seller Information

Inquiry History

NAME:Amelia WHATSAPP:+852-70187112 EMAIL:meng@yxtrading.cn Welcome to concult Haupteigenschaften

Branchenspezifische

Weitere

More Choices Find All Products for Sale 

Related Searches

More from this Seller

NAME:Amelia
WHATSAPP:+852-70187112
EMAIL:meng@yxtrading.cn
Welcome to concult
Haupteigenschaften