Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale
Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale buy - large image1
Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale buy - image1
Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale buy - image2
Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale buy - image3
Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale buy - image4
Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale buy - image5
Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale buy - image6

Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale

TDS 1 Inquiries

Unit Price:

$70/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Reagent Grade

Content:

99.9%

Port:

China

Brand:

YiXin

Packaging:

10vials/box 5mg*10vials

Price valid (until):

2026-08-16

Company Type:
Trader
Location:
China
Qualification:
Main Products:

polypeptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Detailed Product Description




    NAME:Amelia
    WHATSAPP:+852-70187112
    EMAIL:meng@yxtrading.cn
    Welcome to concult
    Haupteigenschaften

    Branchenspezifische

    CAS-Nr. \
    Reinheit 99.9%

    Weitere

    Place of Origin Shandong, China
    Consumption Cosmetic raw materials
    Appearance White powder
    Brand yixin
    Brand name Avoid direct sunlight in a cool and dry place.
    Shelf life 2 years
    MOQ 1 milligram
    Packaging plastic bottle
    Sample Available
    EINECS No. \


    Peptide Product Description

    Small-molecule peptides penetrate deeply, repair and nourish for firm, supple state.

    These products are APIs (Active Pharmaceutical Ingredient) and not a finished drug. 

    It is intended strictly for research and laboratory use only.

    Buyers are required to fully comply with all applicable laws and regulations regarding the handling and use of this material.



    product details


    Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 1



    Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 2


    Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 3


    Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 4

    Company Profile

    Our company has a complete range of building and decoration chemical materials, and the factory takes product quality as its goal. The company adheres to the principles of integrity, quality first, active development, and quality service, serves customers with a professional and responsible spirit, and continuously improves and innovates to meet customer needs. The quality goal is to achieve zero defects and zero complaints, and serve customers with a professional and responsible spirit


    Shop High Purity Tirzepatide Peptide Powder For Research Weight Loss CAS 2023788-19-2-Detailed Image 3

    Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 6 Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 7

    Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 8

    our services


    1. We supply Peptides, APIs & Intermediates and so on to satisfy your needs;  
    2. We will reply you for your inquiry in 24 hours;  
    3. Strictly on selecting raw materials . Our Q&C team will inspect every product quality strictly before delivery;

    4. Reasonable & competitive price, fast lead time ;

    5. After delivery, we will track the products for you once every two days, until you get the products. When you got the goods, if you have any questions about the problem, contact with us, we will offer the solve way for you ;

    6. 100% safe delivery, guaranteed delivery .

     

    payment method 

    Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 9


    Our Advantages

    1. We have long-term cooperation with the Europe&North America&South America&Middle East&Asia export.

    2. There are long-term and stable transportation companies in transportation, which can ensure 100% delivery of goods.

    3. We can customize and develop various corresponding products according to the special requirements of customers, and provide customers with strong technical support and a complete set of industry solutions.

    4. We provide the best private label OEM and ODM services to meet different customers. Feel free to contact us!

    Product Packaging





    Shop High Purity Tirzepatide Peptide Powder For Research Weight Loss CAS 2023788-19-2-Detailed Image 4 Shop High Purity Tirzepatide Peptide Powder For Research Weight Loss CAS 2023788-19-2-Detailed Image 5 Shop High Purity Tirzepatide Peptide Powder For Research Weight Loss CAS 2023788-19-2-Detailed Image 6


    Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 13 Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 14 Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 15

    Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 16
    Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 17
    Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 18
    Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 19

    1. Ultra-High Purity

    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    mode of transportation


    Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 20 Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 21 Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 22


    Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 23.Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 24 Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 25

    Q: How to store it?

    A: If it hasn't been opened, just put it in cool dry place, if it is opened, you may put it in cold storage for 2-5 degree condition.

    Q: How to order this product?

    A: You can click "contact Supplier" , or write an email to my inbox, and send us a inquiry, leave your number if possible, we will contact with you as soon as possible, then we can talk order details.

    Q: How about the delivery time?

    A: Shipped within 48 hours after payment is received.Small orders are shipped via express door-to-door.The goods arrive in about7-10 days.

    Q : ls cash on delivery ?

    A:in most cases,we don't support cash on delivery.

    Q: How much is the commodity?

    A: As we all know, the price of chemicals is not fixed, but fluctuates with the market.

    You need to contact me to get the latest product price, we promise to give you the most favorable price.

    Q:About the after-sale service?

    A:After purchasing the products from our Company, we have a professional technical team and after-sales team to serve you and solve all your problems in the future.


    Company Profile  

    We have many years of trading experience and are professional   Chemical raw materials, medicine, Pharmaceutical raw material suppliers in overseas . Hope to cooperate with you for a long time and achieve win-win purpose. Our experienced staff is committed to strict quality control and attentive customer service and is always available to discuss your requirements and ensure complete customer satisfaction. Our company firmly believes that all products must comply with international quality standards. We therefore focus on sourcing quality materials and ensuring strict internal process controls. Our professional inspectors ensure that the products delivered to our customers are perfect. Our company adhere to the "customer first, reputation assurance, quality assurance, professional service" policy. No matter what type of product you need, you can contact us at any time, we will provide high quality products in the fastest and best way to achieve customer satisfaction. In addition, we will provide the best service to our customers. We look forward to establishing long-term business relations with overseas on the basis of mutual benefit in the near future. If you are interested in our products or companies, please feel free to contact us for more details!
    Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 26 Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 27 Shop Pure 5-Amino-1MQ Bulk Powder, Unmixed 5Amino1MQ Compound for Laboratory Stud-Detailed Image 28

    Certificates
    • Research Grade LL-37 Cathelicidin Antimicrobial Peptide Raw Material 5mg 10mg Vial Bulk Wholesale Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    polypeptide

    Location:

    No. 4, 4th Floor, Building D1, Bili La Park, Lu Shang Road, Dongcheng Street, Economic and Technological Development Zone, Liaocheng City, Shandong Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    101-200

    Year of Establishment:

    2025

    Certifications:

    Tirzepatide,Tirzepatide


    15 Years of Industry Experience

    We have been a high-tech company focused on the development, production, and marketing of various peptide products for 15 years. Through advanced laboratories and strict quality control, our internationally certified products are safe and effective.

    Clients in Europe, the USA, Southeast Asia, the Middle East
    As a global trading company, we serve clients in Europe, the USA, Southeast Asia, the Middle East, and beyond and provide customized solutions. Committed to "technology leading Health", we aim to innovate and deliver high-quality health products worldwide.

    3,000-square-meter Factory with 60 Employees
    We have a factory covering 3,000 square meters and housing 60 employees to guarantee the highest quality all the time. We hired three quality auditors with three years of experience. They meticulously inspect each item at every production stage.

    Contact Us Now
    Our products are exported to more than 130 countries and regions, which can be delivered fast within 5-14 days. We can provide OEM/ODM support to our customers. We have 10 professional after-sales staff to make 24-hour responses to our customers. Contact us now to learn more.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.