Please contact us via
WhatsApp at: +852 53752509
email: gx@tianjinaoxin.com
Here is an English product overvied for LL37 :
Composition:
LL-37 is a synthetic cationic antimicrobial peptide corresponding to the C-terminal 37‑amino‑acid cleavage product of human cathelicidin hCAP18, with the sequence [LL-37, 37 aa] (molecular formula C₁₉₈H₃₆₈N₆₆O₅₃, MW ≈ 4493 Da); it is produced by solid‑phase peptide synthesis or recombinant expression systems and supplied as a high‑purity lyophilized powder for laboratory research.
Mechanism of Action:
It exerts broad-spectrum antimicrobial activity primarily through electrostatic interaction with negatively charged microbial membranes—particularly those of Gram‑negative and Gram‑positive bacteria, certain fungi, and enveloped viruses—followed by peptide insertion, pore formation (via carpet or toroidal-pore models), and membrane depolarization leading to cytoplasmic leakage. In addition to direct microbicidal effects, LL-37 functions as a host-defense immunomodulator by binding to and signaling through formyl peptide receptor‑like 1 (FPRL1/ALX) and P2X₇ receptors on neutrophils, monocytes, and epithelial cells, thereby promoting chemotaxis, cytokine secretion (e.g., IL‑1β, TNF‑α), wound‑healing–associated angiogenesis, and resolution of inflammation.
Research Advantages:
Unlike conventional antibiotics, LL-37 acts on conserved membrane lipid components rather than specific microbial enzymes or ribosomes, making it a valuable model for studying mechanisms of antibiotic resistance avoidance and innate immune activation. Its dual role—simultaneous antimicrobial action and immunomodulatory signaling—allows researchers to investigate multicellular innate responses, epithelial barrier function, and peptide‑mediated modulation of TLR signaling and autophagy in a single system; it also demonstrates measurable activity in serum‑containing media at micromolar concentrations and is amenable to site‑directed analog design for structure–activity relationship studies.
Intended Research Population:
This compound is designated for in vitro and non‑clinical ex vivo studies involving antimicrobial peptide mechanisms, host‑defense immunology, epithelial barrier models (skin, airway, gut), wound‑healing assays, sepsis‑related cytokine storm models, and autoimmune conditions such as psoriasis where cathelicidin dysregulation is implicated; it remains an investigational reagent restricted to scientific laboratory use and is not approved for therapeutic, diagnostic, or human/animal administration outside controlled experimental protocols.
Tianjin Aoxin Biotechnology Co., Ltd. is a high-tech enterprise specializing in the research, production and sales of peptide products. With advanced laboratories and strict quality control systems, our products have obtained international certifications, ensuring safety and effectiveness.
Our customers are located in Europe, the United States, Southeast Asia, the Middle East and other regions.
As a global trading company, we provide customized solutions for customers in Europe, the United States, Southeast Asia, the Middle East and many other regions. Adhering to the concept of "Technology leads to health", we are committed to innovation and strive to provide high-quality health products for global consumers.
Business philosophy
Based on the domestic market, we have increased investment in research and development, produced high-quality products, and promoted environmental protection and sustainable development through technology. At the same time, we actively expand the international market, sincerely serve society, and strive to become a modern, environmentally friendly, and advanced technology enterprise with global standards. Contact Us
Our products have been exported to 130 countries and regions. We are committed to establishing stable, strategic and long-term partnerships with both domestic and international suppliers and customers, working together to create a brighter future.
Transportation and packaging：
Product Packaging: Each box contains 10 pieces (the size, label and packaging box can be customized according to customer requirements).
Transport Conditions: This product is transported as a non-hazardous chemical at normal temperature. During ordinary transportation and customs clearance, this product can be stably stored for several weeks. Storage Conditions: For short-term storage (from a few days to several weeks), it should be placed in a dry and cool place at 0-4℃. For long-term storage (from several months to several years), it should be stored at -20℃. After re-dissolution, please store it refrigerated at 2-8℃ (35.6-46.4℉) and use it within 2-4 weeks.
We mainly adopt dedicated logistics and FedEx transportation methods, which can ensure the timeliness of shipment, rapid delivery, stable logistics tracking, and safe and punctual delivery.Quick delivery
Regarding after-sales service
A: After you purchase the products from our laboratory, we will have a professional technical team and an after-sales team to serve you and solve all the problems you may encounter in the future.
FAQ
Q: How to order this product?
A:You can send us your Purchase order(if your company has), or just send a simple confirmation by email or message, we will send you order confirmation, then you can make your order accordingly.
Q: How long can I receive my ordered goods?
A: We ship by special line shipping door to door; you can receive it in about 3-10days.
Q: What's your MOQ?
A:For the regular products, our MOQ is 1box; For other customized products, our MOQ starts from 10boxes to 50boxes.
Q: Is there a discount?
A: Yes, for larger quantity order, we always support with better price.
Q: How to store it?
A: If it hasn't been opened, just put it in cool dry place, if it is opened, you may put it in cold storage for 2-5 degree condition.
Q：We have clients throughout the world
A：1)Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.
2)Market feedback and goods feedback will be appreciated, meeting customers' requirement is our principal responsibility.
3)High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.
Q：How to proceed your order:
Step 1:Add my WhatsApp number,Please let me know the items you are favorable, quantities, and the destination country.
Step 2:You confirm all detail, and offer purchasing order.
Step 3:We send the detail price of our product and offer the suitable shipping method for reference.
Step 4:You confirm the order and payment 100% in advance and send us the detailed contacting information, including contacting person/company,address,mobile number,ZIP code and your special requirements.
Step5:We arrange the shipment according to your requirements, and tracking code will be offered once it is released, then you can track your parcel at any moment.
Step 6:We offer after-sales services after service after you receive your parcel
TDS
Indonesia
