Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > Teriparatide acetate CAS 52232-67-4 Peptide Raw Powder High Quality 98% Assay
Teriparatide acetate CAS 52232-67-4 Peptide Raw Powder High Quality 98% Assay buy - large image1
Teriparatide acetate CAS 52232-67-4 Peptide Raw Powder High Quality 98% Assay buy - image1
Teriparatide acetate CAS 52232-67-4 Peptide Raw Powder High Quality 98% Assay buy - image2
Teriparatide acetate CAS 52232-67-4 Peptide Raw Powder High Quality 98% Assay buy - image3
Teriparatide acetate CAS 52232-67-4 Peptide Raw Powder High Quality 98% Assay buy - image4
Teriparatide acetate CAS 52232-67-4 Peptide Raw Powder High Quality 98% Assay buy - image5
Teriparatide acetate CAS 52232-67-4 Peptide Raw Powder High Quality 98% Assay buy - image6

Teriparatide acetate CAS 52232-67-4 Peptide Raw Powder High Quality 98% Assay

TDS 14 Inquiries

Unit Price: Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shanghai

Brand:

HyperChem

Packaging:

1kg/Bag, 25kg/drum

Price valid (until):

2026-06-29

Company Type:
Trader
Location:
China
Payment Terms:
TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance
Average Lead Time:
10 days
Qualification:
Main Products:

Pharmaceuticals,Peptide,Cosmetics,Nutritional Supplements

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Name

    Teriparatide acetate

    CAS number

    52232-67-4

    EINECS number

    640-978-1

    Synonym

    Teriparatideacetate; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    Description

    Teriparatide acetate can mediate bone metabolism by inhibiting osteoblast apoptosis, activating bone lining cells, and enhancing osteoblast differentiation.

    Structure

    Shop Teriparatide acetate CAS 52232-67-4 Peptide Raw Powder High Quality 98% Assay-Detailed Image 1

    Molecular Formula

    C172H278N52O47S2

    Molecular Weight

    3890.49792g/mol

    Appearance

    White powder

    Quality Standard

    In-house

    Assay

    99.1%

    Sample package

    Aluminium foil bag

    Commercial package

    Aluminium Tin, Fiber drum

    Origin

    China


    More Info

    Teriparatide acetate is a synthetic, recombinant form of human parathyroid hormone (1-34) used as a potent bone-building (anabolic) therapy. It is primarily prescribed to treat severe osteoporosis in high-risk patients by stimulating new bone formation and increasing bone mineral density, significantly reducing the risk of fractures.


    Mechanism

    Binds to PTH1 receptors, stimulating osteoblasts (bone-forming cells) more than osteoclasts (bone-resorbing cells).


    Side Effects

    Common side effects include nausea, joint or back pain, and dizziness. Rare but serious risks can include elevated calcium levels (hypercalcemia).



















    Package Image

    Shop High Quality Oxytocin CAS 50-56-6-Detailed Image 2

    Shop USP Quality Standard API Finasteride Powder with CAS 98319-26-7-Detailed Image 3



    FAQ

    Q1. Can I get a free sample?

    We can send you a samll free sample, and you only need to pay for the shipping cost.


    Q2. What is the HyperChem payment term?

    T/T in advance
    LC at sight
    DP at sight

    Bank transfer

    PayPal

    Bitcoin...


    Q3. What is HyperChem shipment policy?

    Our policy is to strive for the quickest shipment time possible.

    For ready stock samples, they are usually shipped within 3 working days after payment received.
    For non-ready stock, please contact HyperChem sales team to negotiate.


    Q4. What is HyperChem shipment term?

    By Express  
    FedEx  UPS  DHL  EMS                               
    Fast: 3-7 days around, high cost, door to door service

    By Air                                        
    Suitable for more than 50kg 
    Fast: 3-7 days, hight cost, port to port, professional broker needed 

    By Sea
    Suitable for more than 500kg      
    Fast: 7-45 days, low cost, port to port, professional broker needed 


    We will always attempt to utilize the quickest and most affordable way for customers to receive orders. And follow -up with customers via email for all shipment details as well as updated track information until it arrives without damage.


    Q5. What HyperChem will provide after shipment?

    For sample orders: 
    After shipment is done, an timely email including:

    1. Track details (Fedex /TNT/DHL/EMS Track number)
    2. Packaging photo
    3. COA, MSDS, etc
    4. Dispatch date & Estimated arriving time
    5. Shipping invoice

    For commercial orders
    A full set of shipment documents as well as package photos can be provided in scan-copy and original, to help customers complete the customs clearance process.



    Company Profile

    Established in 2013, Hyper Chem has exclusive tie-ups with leading manufacturers, supplying raw materials produced in GMP and ISO 9002 certified facilities, and provides high-quality ingredients and raw materials to cater to the requirements of our diverse range of clients.


    Among them, our key client industrial sectors around the global are:

    Pharmaceuticals
    Nutrition Ingredients/ Dietary supplements
    Cosmetic Ingredients
    Food Ingredients
    Veterinary API
    Agriculture fertilizer
    Custom Synthesis lab supply


    HyperChem provides to its wonderful and honorable clients comprehensive purchasing and distribution services which ensure that we are delivering the right generic, raw, or customized product, make sure that we are delivering it at the right time, ensure that it is delivered in the specified amount, and in the right kind of packaging to clients and customers of all types of industries irrespective of their size of operation.




    ECHEMI Editorial Reference
    The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
    Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.
    Research & Reference Note

    Teriparatide acetate CAS 52232-67-4 Peptide Raw Powder High Quality 98% Assay is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Pharmaceuticals,Peptide,Cosmetics,Nutritional Supplements

    Location:

    Rm. 803, Tower 4, LOFT49 Creative City Pioneer Zone, No.88 Jiru Rd. Gongshu Dist., Hangzhou, 310015 ZJ, China

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    10 days

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    11-50

    Year of Establishment:

    2013

    Company Certificates
    • Hangzhou Hyper Chemicals LimitedCertification Report by Bureau Veritas Certification Report by Bureau Veritas
    About HyperChem

    Established in 2013, Hyper Chem has exclusive tie-ups with leading manufacturers, supplying raw materials produced in GMP and ISO 9002 certified facilities, and provides high-quality ingredients and raw materials to meet the needs of a diverse range of pharmaceutical cosmetics ingredients and nootropic supplements companies worldwide.

    Our Competitiveness

    One-stop supply

    Wide Range Of products including pharmaceutical, Cosmetic Ingredients and nootropic supplements

    Among all the pharmaceuticals,

    90% of them with GMP certificates,

    85% of them with DMF files and

    50% of them passed FDA approval,

    30% get CEP certificate

    20% are new R&D products.

    Custom Repackaging Service


    We can efficiently repackage your material into sample sizes, custom batch-specific sizes, or semi-bulk package sizes according to your specifications. And ensures the product is packaged in a quality-controlled environment and will maintain its integrity throughout every stage of the process.

    Quality Control/Quality Assurance


    HyperChem is committed to delivering on its promises of top-quality products with verified quality data.

    All materials are vigorously inspected by the factory and/or outsourced analytical laboratories to ensure each and every lot meets or exceeds our reference standards.

    Trade assurance service with 100% payment protection, It is best achieved by delivering products and services 100% right the first time, on time, every time.

    Professional

    Transparent Communication

    Fast Reaction,

    Professional Suggestion

    Beyond Expectation.

    We have exclusive partnerships with research and production facilities across the country and we offer varied pharmaceutical services in the most cost-efficient way. The production facilities are GMP, WHO-GMP, EU GMP and US FDA approved and are backed by strong regulatory support such as Dossier, DMF, Tech Pack and relevant Stability studies for regulatory filings.

  • Inquiry History
    14 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    United States

    teriparatide

    1 G Sep 6, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Russia

    Teriparatide

    1 G Sep 12, 2026
    Russia

    Teriparatide

    1 G Sep 12, 2026
    United States

    Teriparatide kit of 10 2mg vials

    1 MT Sep 7, 2026
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.