Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL-37 99%+ High Purity Cosmetic Raw Material 5 mg per Vial
LL-37   99%+ High Purity Cosmetic Raw Material  5 mg per Vial buy - large image1
LL-37   99%+ High Purity Cosmetic Raw Material  5 mg per Vial buy - image1
LL-37   99%+ High Purity Cosmetic Raw Material  5 mg per Vial buy - image2
LL-37   99%+ High Purity Cosmetic Raw Material  5 mg per Vial buy - image3
LL-37   99%+ High Purity Cosmetic Raw Material  5 mg per Vial buy - image4
LL-37   99%+ High Purity Cosmetic Raw Material  5 mg per Vial buy - image5
LL-37   99%+ High Purity Cosmetic Raw Material  5 mg per Vial buy - image6

LL-37 99%+ High Purity Cosmetic Raw Material 5 mg per Vial

TDS

Unit Price:

$20-25/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GUANGZHOU

Brand:

APKX

Packaging:

5mg per Vial

Price valid (until):

2027-09-27

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Description


      Product Detail  



    Product Description



    LL-37 is a synthetic 37‑amino‑acid cationic peptide with the sequence [LL-37, 37 aa] It is the only known human cathelicidin – a class of host defense peptides that form a critical component of the innate immune system. The peptide is derived from the C‑terminal end of the hCAP‑18 precursor protein, which is encoded by the human CAMP gene. LL-37 is characterized by its high positive charge (+6 at neutral pH) and amphipathic α‑helical structure when in contact with biological membranes.

    .

    1. Ultra-High Purity

    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.
    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.
    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.


    Sales manager:  Eira

    whatsapp:+8619304441463 

    whatsapp:+852 9546  9358

    Email:  sales01@cnspks.com


    1. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.


    2. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.


    Shop IGF 1LR3-Detailed Image 1


    Shop IGF 1LR3-Detailed Image 2 Shop IGF 1LR3-Detailed Image 3


    Q1: May I get one sample before placing order?
    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.
    Q2: Which payment is available for your company?
    Re: T/T, PayPal,bank transfer etc. You can choose the one which is convenient for you.
    Q3: How and when can I get my goods after payment?
    Re: For small quantity products, they will be delivered to you by international courier(DHL, FedEx, TNT etc.) or by air. Usually it will cost 5-7days that you can get the goods after delivery.For large quantity products, shipping by see is worthwhile.It will cost 15 to 30 days to come to your destination port, which depends on where the port is.
    Q4: Is there any possible to use my appointed label or package?
    Re: Yes. If needed, we'd lik.


    Shop IGF 1LR3-Detailed Image 4


    Shop IGF 1LR3-Detailed Image 5

    1. Expertise in Peptide Synthesis
    Extensive Experience: 7 Years of expertise in synthetic peptide development.
    Skilled Team: Experts in solid-phase and liquid-phase synthesis.
    2. Advanced Manufacturing Capabilities
    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.
    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.
    3. Innovation & Customer Commitment
    Reliable Supply Chain: Competitive pricing & timely global delivery.
    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.
    4. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.
    5.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.
    6.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.



    Shop IGF 1LR3-Detailed Image 6 Shop IGF 1LR3-Detailed Image 7


    Why Choose Our Peptides?

    • Quality Assured: Sourced from trusted manufacturers with reliable global distribution, ensuring consistency and potency .
    • Holistic Support: Complements weight management programs, metabolic health goals, and sleep apnea treatment plans—addressing root causes for lasting impact .

    • Why Partner with us?


      Quality Assurance:

      Manufactured in GMP-certified facilities with full traceability and regulatory-aligned documentation.

      Flexible Supply:

      Available in multiple formats. Consistent lead times with flexible production capacity.

      Competitive Edge:

      Factory-direct pricing with volume discounts; stable supply chain to meet your market demand.

      Technical Support:

      Full documentation and formulation guidance.

    Shop IGF 1LR3-Detailed Image 8


    Shop IGF 1LR3-Detailed Image 9


    Shop IGF 1LR3-Detailed Image 10



    Items Specifications
    Product NameSelank LL-37
    CAS No.
    • 154947-66-7

    Storage Store in a cool and dry place



    Shipping & Payment Information



    • Global Shipping – US, Europe, Southeast Asia, Middle East, and more

    • Packaging – Vacuum-sealed + discreet outer box 

    • Delivery Time – Approximately 7–20 days depending on region

    • Payment Methods – Bank transfer, USDT, Alipay, WeChat (negotiable)


    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    Room 3043, 3rd Floor, Building 15, No. 185 Xinda Road, Wanghailou Street, Hebei District, Tianjin

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    11-50

    Year of Establishment:

    2025

    Certifications:

    .,证书


       公司简介  


    Company Profile
    We are a modern, rapidly growing biopharmaceutical company specializing in the production of pharmaceuticals, biologics, and nutraceuticals. We offer internationally leading healthcare products, chemicals, electronics, and mining machinery. Our innovative, full-cycle production facilities fully comply with GMP and ISO standards. We are committed to providing high-quality, affordable, innovative products to prevent disease and support healthier lifestyles. We optimize scientific innovation and production technologies to enable our customers to better serve their consumers. We provide a comprehensive range of services and products for the pharmaceutical and nutraceutical industries, from custom development and production of active ingredients to finished dosage forms. With our scale and resources, we offer our customers one-stop solutions to help people get, feel, and stay well.
    
  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.