Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Hot-sale LL37 99% Purity and High Quality Factory Direct Sales Peptide
Hot-sale LL37 99% Purity and High Quality Factory Direct Sales Peptide buy - large image1
Hot-sale LL37 99% Purity and High Quality Factory Direct Sales Peptide buy - image1
Hot-sale LL37 99% Purity and High Quality Factory Direct Sales Peptide buy - image2
Hot-sale LL37 99% Purity and High Quality Factory Direct Sales Peptide buy - image3
Hot-sale LL37 99% Purity and High Quality Factory Direct Sales Peptide buy - image4
Hot-sale LL37 99% Purity and High Quality Factory Direct Sales Peptide buy - image5
Hot-sale LL37 99% Purity and High Quality Factory Direct Sales Peptide buy - image6

Hot-sale LL37 99% Purity and High Quality Factory Direct Sales Peptide

TDS

Unit Price:

$10/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

qingdao

Brand:

Accept customization

Packaging:

10mg*10vials/box

Price valid (until):

2028-03-30

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Description

    Shop Factory Wholesale Super Collagen Protein Peptide Powder AHK-Cu Hyaluronic Acid Vitamin C Supplement For Beauty Skin And Anti-Aging-Detailed Image 1

    Peptide

    Peptide products offer diverse functional benefits across multiple scenarios:


    in health management, peptides support metabolic regulation (aiding in blood sugar control and healthy weight management for specific groups) and immune system modulation by enhancing the body's defense responses; 


    in skincare, peptides promote skin barrier repair, boost collagen synthesis to reduce fine lines, and improve skin hydration and elasticity; 


    in sports nutrition, peptides assist in muscle recovery by reducing post-exercise tissue damage and supporting muscle protein synthesis.

    Shop Factory Wholesale Super Collagen Protein Peptide Powder AHK-Cu Hyaluronic Acid Vitamin C Supplement For Beauty Skin And Anti-Aging-Detailed Image 2  Shop Factory Wholesale Super Collagen Protein Peptide Powder AHK-Cu Hyaluronic Acid Vitamin C Supplement For Beauty Skin And Anti-Aging-Detailed Image 5 Shop Hot-sale LL37 99% Purity and High Quality Factory Direct Sales Peptide-Detailed Image 4 Shop Hot-sale LL37 99% Purity and High Quality Factory Direct Sales Peptide-Detailed Image 5

    Why Choose Our Peptides?

    • Clinically Relevant: Aligns with global trends in peptide therapeutics, a market projected to reach $83.75B by 2034 .
    • Quality Assured: Sourced from trusted manufacturers with reliable global distribution, ensuring consistency and potency .
    • Holistic Support: Complements weight management programs, metabolic health goals, and sleep apnea treatment plans—addressing root causes for lasting impact .

    Key Search Terms:

    Prescription peptide for weight loss, obesity peptide therapy, OSA treatment peptides, high-purity weight loss peptides, custom peptides formulations, GLP-1 related peptides, injectable peptide for weight management, peptide supplements for metabolic health
    Customizable peptide
    Skin care peptide
    Beauty peptide
    Muscle building peptide
    Hair growth peptide
    Weight loss peptide
    Fitness peptide

    Shop High Quality Factory Price Supplement MT-2 Peptides Powder-Detailed Image 6




    Payment

    We accept payment methods such as T/T, D/P, Paypal and Money Gram.

    Shop Factory Wholesale Super Collagen Protein Peptide Powder AHK-Cu Hyaluronic Acid Vitamin C Supplement For Beauty Skin And Anti-Aging-Detailed Image 6


    Packing & Delivery

    Shop Factory Wholesale Super Collagen Protein Peptide Powder AHK-Cu Hyaluronic Acid Vitamin C Supplement For Beauty Skin And Anti-Aging-Detailed Image 7 Shop Factory Wholesale Super Collagen Protein Peptide Powder AHK-Cu Hyaluronic Acid Vitamin C Supplement For Beauty Skin And Anti-Aging-Detailed Image 8  Shop Factory Wholesale Super Collagen Protein Peptide Powder AHK-Cu Hyaluronic Acid Vitamin C Supplement For Beauty Skin And Anti-Aging-Detailed Image 9

    As a professional supplier of weight loss peptides, we provide high-quality products and integrated services to medical institutions, health management organizations, and individual users through a global supply chain network and compliant operation system.


    All our peptide products(wholesale Peptides 99.9% Purity) boast a purity of ≥99% with third-party test reports, sourced from GMP-certified manufacturing partners and produced in line with international standards such as FDA DMF filing requirements.


    Coperations are certified by ISO 9001, with some products holding WHO prequalification;  every batch undergoes strict quality inspections (HPLC purity testing, microbial limit analysis, etc.) to guarantee full traceability.


    Committed to cost-effectiveness and sustainability, we eliminate middlemen to offer products 30-50% more affordable than originators, while promoting green production practices and strict compliance with global pharmaceutical regulations.


    Shop Factory Wholesale Super Collagen Protein Peptide Powder AHK-Cu Hyaluronic Acid Vitamin C Supplement For Beauty Skin And Anti-Aging-Detailed Image 10


    FAQ

    Q1: About the after-sale service

    A: After purchasing the products from our Lab, we have A professional technical team and after-sales team to serve you and solve all your problems in the future


    Q2: Do you have stock?

    A: We understand most customers prefer stock, so we'll try to keep stock for most products. However, for some rare products, we won't keep stock and it needs time to synthesize.


    Q3: How do I start paying?

    Payment can be made by Bitcoin,wire transfer or paypal


    Q4: How to confirm product quality before placing an order?

    A: We got good feedback from customers and Tested by third-party institutions. You also can get free samples of some products. You just have to pay the shipping fee for the sample .

    You can send us your product specifications and requirements and we can customize for you.


    Q5: What is your MOQ?

    A: The minimum quantity we can order is 1 box.

    But usually we can accept a smaller quantity, say 100g, at the cost of 100% sample charge.


    Q6: Time for delivery?

    A: Leading time within 3 business days,Shipping time about 8-10 business days. 


    Q7: Why should I choose you?

    A: Powerful technical support-come from our highly skilled & fully experienced staff, working in chemical industry for over 5years, in average.Strict quality control-comes form our sophisticated management system.Professional and warm sales team-since we believe we can only win via our hard work in a competitive world.Quick response and excellent presale and after sale service-since we believe our customers deserve all the best service.

    Items Specifications
    Apperance Powder
    Key words 375
    Function Anti-aging


    Certificates
    • Hot-sale LL37 99% Purity and High Quality Factory Direct Sales Peptide Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    Room 1001, Unit 2, Building 30, Xing'an Community, Dongcheng Street, Ancheng Town, Pingyin District, Jinan City, Shandong Province,China

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2022


      Company Profile  


    Ktechpeptide Company, founded in 2022, stands out with robust research and development strength, top-tier synthesis techniques, and state-of-the-art quality assurance protocols. We proactively pursue strategic alliances and collaborative projects with leading enterprises and manufacturers globally, driven by an industrial development ethos dedicated to serving society and delivering value to our customers. Guided by market needs, we continuously innovate and synthesize cutting-edge high-tech chemical products and pharmaceutical intermediates. With rich experience in international trade, our products are mainly exported to markets including the United States, Europe, India, South Africa, and Nigeria. We ensure safe and reliable logistics, enabling every client to receive their shipments securely and promptly.

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.