Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 Factory direct sales Low price High Quality Fast Delivery and Great Prices
LL37 Factory direct sales Low price High Quality Fast Delivery and Great Prices buy - large image1
LL37 Factory direct sales Low price High Quality Fast Delivery and Great Prices buy - image1
LL37 Factory direct sales Low price High Quality Fast Delivery and Great Prices buy - image2
LL37 Factory direct sales Low price High Quality Fast Delivery and Great Prices buy - image3
LL37 Factory direct sales Low price High Quality Fast Delivery and Great Prices buy - image4
LL37 Factory direct sales Low price High Quality Fast Delivery and Great Prices buy - image5
LL37 Factory direct sales Low price High Quality Fast Delivery and Great Prices buy - image6

LL37 Factory direct sales Low price High Quality Fast Delivery and Great Prices

1 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shanghai

Brand:

JL

Packaging:

box

Price valid (until):

2026-07-12

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description
    Description

    Name:Artemis

    email: yanhongbo6@jielupeptide.com

    whatsapp: +852 56964225

    Wholesale Price  

    375 5mg 85


    Peptide

    Peptide products offer diverse functional benefits across multiple scenarios:


    in health management, peptides support metabolic regulation (aiding in blood sugar control and healthy weight management for specific groups) and immune system modulation by enhancing the body's defense responses; 


    in skincare, peptides promote skin barrier repair, boost collagen synthesis to reduce fine lines, and improve skin hydration and elasticity; 


    in sports nutrition, peptides assist in muscle recovery by reducing post-exercise tissue damage and supporting muscle protein synthesis.

    Why Choose Our Peptides?

    • Clinically Relevant: Aligns with global trends in peptide therapeutics, a market projected to reach $83.75B by 2034 .
    • Quality Assured: Sourced from trusted manufacturers with reliable global distribution, ensuring consistency and potency .
    • Holistic Support: Complements weight management programs, metabolic health goals, and sleep apnea treatment plans—addressing root causes for lasting impact .

    Key Search Terms:

    Prescription peptide for weight loss, obesity peptide therapy, OSA treatment peptides, high-purity weight loss peptides, custom peptides formulations, GLP-1 related peptides,  peptide for weight management, peptide supplements for metabolic health
    Customizable peptide
    Skin care peptide
    Beauty peptide
    Muscle building peptide
    Hair growth peptide
    Weight loss peptide
    Fitness peptide
    Shop Tirzepatide Low price High Quality Fast Delivery and Great Prices-Detailed Image 1 Shop Tirzepatide Low price High Quality Fast Delivery and Great Prices-Detailed Image 2 Shop Retatrutida Low price High Quality Fast Delivery and Great Prices-Detailed Image 2

    Retatrutide   (LY3437943) acetate is a triple agonist peptide for the glucagon receptor (GCGR), glucose-dependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R).

    Retatrutide acetate inhibits human GCGR, GIPR, and GLP-1R with EC50 values of 5.79, 0.0643, and 0.775 nM, respectively. It exhibits activity on mouse GCGR, GIPR, and GLP-1R with EC50 values of 2.32, 0.191, and 0.794 nM, respectively.

    In vivo, Retatrutide (LY3437943) acetate engages with GCGR and enhances glucose tolerance in an ipGTT by acting through GIP or GLP-1 receptors. Activation via the glucagon receptor by Retatrutide acetate leads to significant weight reduction and increased energy expenditure. Retatrutide acetate can be utilized in research related to obesity.

    Tirzepatide (M-ounjaro) is a novel medication indicated as an adjunct to diet and exercise in the treatment of patients with type 2 diabetes mellitus. Tirzepatide is a dual receptor agonist, acting on glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) to lower blood glucose levels.
      Tirzepatide is a dual glucose-dependent insulinotropic polypeptide (GIP) and GLP-1 agonist that has been studied recently as a treatment for patients with noncirrhotic NASH (SYNERGY-NASH, NCT04166773) given its association with significant weight loss and improvement in features of metabolic syndrome in diabetes trials.

    Shop Retatrutida Low price High Quality Fast Delivery and Great Prices-Detailed Image 3

    FAQ

    Q1: About the after-sale service

    A: After purchasing the products from our Lab, we have A professional technical team and after-sales team to serve you and solve all your problems in the future

    Q2: Do you have stock?

    A: We understand most customers prefer stock, so we'll try to keep stock for most products. However, for some rare products, we won't keep stock and it needs time to synthesize.

    Q3: How do I start paying?

    Payment can be made bywire transfer or paypal

    Shop Tirzepatide Low price High Quality Fast Delivery and Great Prices-Detailed Image 5

    Q4: What is your MOQ?

    A: The minimum quantity we can order is 1 box.A:。

    But usually we can accept a smaller quantity, say 100g, at the cost of 100% sample charge.

    Q5: Time for delivery?

    A: Leading time within 3 business days,Shipping time about 8-10 business days. A:

    Q7: Why should I choose you?

    A: Powerful technical support-come from our highly skilled & fully experienced staff, working in chemical industry for over 5years, in average.Strict quality control-comes form our sophisticated management system.Professional and warm sales team-since we believe we can only win via our hard work in a competitive world.Quick response and excellent presale and after sale service-since we believe our customers deserve all the best service.A:Shop IGF-1LR3 Factory direct sales Low price High Quality Fast Delivery and Great Prices-Detailed Image 6 Shop IGF-1LR3 Factory direct sales Low price High Quality Fast Delivery and Great Prices-Detailed Image 7


    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide

    Location:

    zhejiangshengjinhuashiyiwushijiangdongjiedaodongnanlu656hao

    Average lead Time:

    15

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    Jielu Trading focuses on the global cross‑border supply chain of high‑end peptide raw materials. Rooted in cutting‑edge biotechnology, we specialize in the selection, quality control, trade and globalized services of peptide products.

    Adhering to strict quality standards and raw material traceability systems, we provide high‑purity and stable peptide raw materials as well as integrated supply‑chain solutions for scientific research, health care and medical aesthetics industries with standardized production and complete compliance qualifications.

    Guided by our brand philosophy With Peptide Power, Integrity Leads Far, Empowering the World, Jielu builds a stable and efficient global trade network with craftsmanship, integrity and global vision. We strive to be an influential benchmark service provider in the worldwide peptide industry, and create a brighter future with global partners.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.