 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Factory Supply LL-37 Antimicrobial Peptide CAS 154947-66-7 Cosmetic Research Grade Lyophilized Powder

Factory Supply LL-37 Antimicrobial Peptide CAS 154947-66-7 Cosmetic Research Grade Lyophilized Powder buy - large image1

Factory Supply LL-37 Antimicrobial Peptide CAS 154947-66-7 Cosmetic Research Grade Lyophilized Powder buy - image1

Factory Supply LL-37 Antimicrobial Peptide CAS 154947-66-7 Cosmetic Research Grade Lyophilized Powder buy - image2

Factory Supply LL-37 Antimicrobial Peptide CAS 154947-66-7 Cosmetic Research Grade Lyophilized Powder buy - image3

Factory Supply LL-37 Antimicrobial Peptide CAS 154947-66-7 Cosmetic Research Grade Lyophilized Powder buy - image4

Factory Supply LL-37 Antimicrobial Peptide CAS 154947-66-7 Cosmetic Research Grade Lyophilized Powder

Name: Factory Supply LL-37 Antimicrobial Peptide CAS 154947-66-7 Cosmetic Research Grade Lyophilized Powder
Brand: zhongshuan
SKU: pr2606171656
Price: 15 USD
Availability: InStock

TDS 4 Inquiries

Unit Price:

$15-17/G FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

zhongshuan

Packaging:

Vial/Bottle/Bag/Carton

Price valid (until):

2027-01-01

Contact Supplier

 Chat Now

Hangzhou Zhongshuan Technology Co., Ltd.

Company Type:

Trader

Location:

China

Average Lead Time:

15 days

Qualification:

Main Products:

peptide

 Visit Store

Product Details
Seller Information
Inquiry History

Description

Sales：Anne
WhatsApp ：+8618034597101
Email ：18034597101@163.com

LL-37 Peptide Full English Introduction

LL-37 Peptide is a naturally occurring antimicrobial peptide derived from the human cathelicidin family. It is a 37-amino-acid cationic peptide that has been widely studied for its role in innate immune response, cellular signaling, and biological defense mechanisms.

This high-quality LL-37 peptide is designed for research and laboratory applications only. It is commonly investigated in areas related to peptide science, immune-related pathways, skin biology, tissue repair research, and molecular studies.

Product Features:

High purity LL-37 peptide
37 amino acid peptide sequence
Cathelicidin family peptide
Suitable for scientific research and laboratory use
Manufactured under strict quality standards

Specifications:

Name: LL-37 Peptide
Type: Synthetic Peptide
Length: 37 Amino Acids
Research Use Only (RUO)
Not for human consumption or medical use

Items	Specifications
CAS RN	154947-66-7
Appearance	White Powder
Purity	99%
Storage condition	-20℃

Core Biological Functions

1. Broad-spectrum Antimicrobial Effect

As cationic amphipathic peptide, it binds negatively charged microbial membranes and breaks membrane structure to kill pathogens directly:

Gram-positive & Gram-negative bacteria
Fungi, enveloped viruses and parasites
Penetrate & destroy bacterial biofilms, hard for bacteria to generate drug resistance compared with common antibiotics

2. Neutralize Endotoxin & Regulate Inflammation

It binds LPS (bacterial endotoxin) to block TLR2/TLR4 inflammatory signaling, suppress overproduction of inflammatory factors to relieve sepsis and excessive inflammatory response.

3. Immune Modulation

Chemoattract neutrophils, monocytes and T cells to infection sites to boost innate immunity
Balance immune activation, mediate communication between innate and adaptive immune system

4. Promote Wound Healing & Tissue Repair

Stimulate migration and proliferation of keratinocytes & fibroblasts to accelerate wound closure
Induce angiogenesis (new blood vessel growth) to supply nutrients for damaged skin/mucosa repair
Deficiency of LL-37 leads to hard-to-heal chronic ulcers

5. Additional Research Directions

Skin barrier protection, relieve skin inflammatory lesions
Anti-tumor research (induce apoptosis of certain tumor cells)
Mucosa defense for respiratory, gastrointestinal and urinary tracts

Name Anne

whatsapp number +8618034597101

PAYMENT METHOD

SHIPPING&DELIVERY

FAQ

Q1: About the after-sale service

A: After purchasing the products from our Lab, we have A professional technical team and after-sales team to serve you and solve all your problems in the future

Q2: Do you have stock?

A: We understand most customers prefer stock, so we'll try to keep stock for most products. However, for some rare products, we won't keep stock and it needs time to synthesize.

Q3: How do I start paying?

Payment can be made by Bitcoin,wire transfer or paypal

Q4: How to confirm product quality before placing an order?

A: We got good feedback from customers and Tested by third-party institutions. You also can get free samples of some products. You just have to pay the shipping fee for the sample .

You can send us your product specifications and requirements and we can customize for you.

Q5: What is your MOQ?

A: The minimum quantity we can order is 1 box.

But usually we can accept a smaller quantity, say 100g, at the cost of 100% sample charge.

Q6: Time for delivery?

A: Leading time within 3 business days,Shipping time about 8-10 business days.

Q7: Why should I choose you?

A: Powerful technical support-come from our highly skilled & fully experienced staff, working in chemical industry for over 5years, in average.Strict quality control-comes form our sophisticated management system.Professional and warm sales team-since we believe we can only win via our hard work in a competitive world.Quick response and excellent presale and after sale service-since we believe our customers deserve all the best service.

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Research & Reference Note

Factory Supply LL-37 Antimicrobial Peptide CAS 154947-66-7 Cosmetic Research Grade Lyophilized Powder is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Authoritative sources

Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Bulk Drug Intermediates

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Trader

Main Products:
peptide

Location:
Room A0693, 6th Floor, Building 3, No.5 Lvtai Road, Zhongtai Subdistrict, Yuhang District, Hangzhou City, Zhejiang Province

Average lead Time:
15 days

Total Annual Revenue:
$1 million-$2.5 million

Total Employees:
51-100

Year of Establishment:
2025

Company Certificates
- TR60 COA
Hangzhou ZhongShuan Technology Co., Ltd. specializes in the R&D and manufacturing of pharmaceutical-grade and healthcare-grade bioactive raw materials and their derivatives, which are widely used in pharmaceuticals, nutraceuticals and cosmetics industries and have gained global recognition for superior bioactivity and safety. Our 100,000-square-meter factory is built in strict compliance with GMP standards, boasting a clean production environment, scientific layout, and complete R&D and manufacturing facilities for deep processing of bioactive raw materials and solvent purification, laying a solid foundation for product quality. We are committed to providing global customers with high-quality products and customized professional solutions, and strive to drive product upgrading across various industries through in-depth cultivation of biotechnology.

Global Market Reach
The company's products, with their outstanding quality and stable performance, are exported to over, including the Middle East, South America, North America, Southeast Asia, Africa, Europe, etc., and have accumulated a good reputation in overseas markets. Relying on our professional team and global resource integration capabilities, we fully leverage our geographical and supply chain advantages, continuously optimize localized operations, and effectively help customers reduce costs and improve efficiency while ensuring high-quality products.

Engaged in Raw Materials for 10+ Years
We are a biotech enterprise engaged in the R&D, production, and sales of peptides and raw materials for more than 10 years. The company has complete experimental facilities. Advanced testing instruments ensure the stability of product quality from all aspects. If you're interested in our products, don't hesitate to contact us.

Inquiry History

4 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
United States	LL-37	10 MG	Oct 17, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
LL37 High Purity And High Quality Factory Direct Sales Peptide 99% Purity	Pharmaceutical Grade/99	$20-25/G FOB	Tianjin Apex Import and Export Trading Co., Ltd.	Inquiry
LL37 high purity and High Quality 99% Purity CAS 154947-66-7 with factory price	Pharmaceutical Grade/99	$95/UNIT FOB	Beijing Novio Biotechnology Co., Ltd.	Inquiry
LL-37 Factory Supply LL 37 CAS 154947-66-7 High quality peptide powder The Human Cathelicidin Antimicrobial Peptide	Pharmaceutical Grade/99	$100/UNIT FOB	Enshi Technology Co., Ltd.	Inquiry
Mini Package LL37 Peptide Raw Powder Individual Vial Custom Label	Pharmaceutical Grade/99	$22/UNIT FOB	HONG KONG BURSON POLYPEPTIDE R&D LIMITED	Inquiry
LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support	Pharmaceutical Grade/99	$50-60/UNIT FOB	Hainan Terte New Materials Co., Ltd.	Inquiry

Factory Supply LL-37 Antimicrobial Peptide CAS 154947-66-7 Cosmetic Research Grade Lyophilized Powder

Product Details

Seller Information

Inquiry History

LL-37 Peptide Full English Introduction

CAS RN

Appearance

White Powder

Purity

99%

Storage condition