Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > China Factory Direct Supply 5-Amino-1MQ Lyophilized Powder Used to Preserve Muscle, CAS No.: 42464-96-0....
China Factory Direct Supply 5-Amino-1MQ Lyophilized Powder Used to Preserve Muscle, CAS No.: 42464-96-0.... buy - large image1
China Factory Direct Supply 5-Amino-1MQ Lyophilized Powder Used to Preserve Muscle, CAS No.: 42464-96-0.... buy - image1
China Factory Direct Supply 5-Amino-1MQ Lyophilized Powder Used to Preserve Muscle, CAS No.: 42464-96-0.... buy - image2
China Factory Direct Supply 5-Amino-1MQ Lyophilized Powder Used to Preserve Muscle, CAS No.: 42464-96-0.... buy - image3
China Factory Direct Supply 5-Amino-1MQ Lyophilized Powder Used to Preserve Muscle, CAS No.: 42464-96-0.... buy - image4
China Factory Direct Supply 5-Amino-1MQ Lyophilized Powder Used to Preserve Muscle, CAS No.: 42464-96-0.... buy - image5
China Factory Direct Supply 5-Amino-1MQ Lyophilized Powder Used to Preserve Muscle, CAS No.: 42464-96-0.... buy - image6

China Factory Direct Supply 5-Amino-1MQ Lyophilized Powder Used to Preserve Muscle, CAS No.: 42464-96-0....

TDS 3 Inquiries

Unit Price:

$1/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Hong Kong

Brand:

customizable

Packaging:

10 bottles per box

Price valid (until):

2027-05-12

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,Survodutide,GHK-CU,GLOW,KLOW

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

                                           Company Profile of Guangzhou Henghuang Trading Co., Ltd.
    Guangzhou Henghuang Trading Co., Ltd. specializes in the field of bioactive peptides. It integrates the supply of high-end peptide raw materials, the output of freeze-dried powder products, and personalized customized production. Based in the Guangdong-Hong Kong-Macao Greater Bay Area, it strives to provide high-standard raw materials and OEM solutions for the beauty and health industries, and empowers brand long-term development with cutting-edge biotechnology.
    The company strictly selects high-quality peptide raw materials, covering a full range of categories such as cosmetic peptides and functional active peptides. The purity of the raw materials strictly complies with the advanced industry standards, and the molecular activity is stable, meeting the diverse needs of product development. The freeze-dried powder is processed through a low-temperature vacuum freeze-drying process, which locks the activity of effective substances to the greatest extent. The quality is stable and suitable for various application scenarios such as hospital-line skincare, daily care products, and health derivatives. We deeply integrate upstream supply chain resources and collaborate with standardized production workshops. We can undertake the full chain services of formula development, formulation blending, specification customization, and packaging outsourcing, flexibly matching batch purchases and niche exclusive customization to meet the differentiated layout of customers.
    The enterprise strictly adheres to strict quality control standards, conducting rigorous verification at every step, from raw material entry, sample testing to product delivery. It firmly maintains the quality bottom line of safety and compliance. With the business philosophy of "craftsmanship for the long term, creating win-win outcomes", it relies on a mature supply chain system and technical service capabilities, while also considering product quality, delivery efficiency and cost advantages.
    Focusing on the market, Henghuang Trading adheres to a high-end positioning, deeply delving into the peptide raw materials and freeze-dried powder sectors, and continuously iterating the raw material categories and production processes. With stable supply, flexible customization, and professional technical support, it serves overseas and domestic cooperative merchants, collaborates with partners to deeply explore the efficacy market, builds a high-quality peptide industry ecosystem, and creates a reliable raw material and customization service provider in the industry.

    Shop Mazdutide 10mg Raw Powder CAS Number 2259884-03-0 Door To Door Service..-Detailed Image 1

                                                       What is a peptide?

    Peptides are small molecules that lie between amino acids and proteins. They have a smaller molecular weight and do not require decomposition. They can be directly absorbed and utilized by the human body, with a much higher utilization rate than ordinary proteins.
    The peptide products available on the market have undergone process purification to remove large molecular impurities, making them suitable for daily body supplementation. As people age, their body's ability to synthesize peptides decreases, leading to problems such as skin sagging, slowed metabolism, and reduced physical strength. Exogenous supplementation can fill the gap.
    Oral peptides can regulate the body's condition, repair internal cells, improve sleep quality, regulate basal metabolism, and help maintain energy; topical skin care peptides can soothe fine lines, firm the skin texture, and repair the damaged skin barrier.
    This product is gentle in composition and suitable for most skin types, differentiating it from ordinary health supplements. By taking it in appropriate amounts on a daily basis, it can improve one's complexion from within and delay signs of aging. The peptides are absorbed quickly and cause little burden on the stomach and intestines. Whether for daily maintenance or for people who stay up late or have irregular sleep schedules, it is suitable as a long-term maintenance option to achieve a state improvement from the inside out.

    Shop Mazdutide 10mg Raw Powder CAS Number 2259884-03-0 Door To Door Service..-Detailed Image 2 Shop Mazdutide 10mg Raw Powder CAS Number 2259884-03-0 Door To Door Service..-Detailed Image 3 Shop Mazdutide 10mg Raw Powder CAS Number 2259884-03-0 Door To Door Service..-Detailed Image 4 Shop Mazdutide 10mg Raw Powder CAS Number 2259884-03-0 Door To Door Service..-Detailed Image 5 Shop Mazdutide 10mg Raw Powder CAS Number 2259884-03-0 Door To Door Service..-Detailed Image 6 Shop Mazdutide 10mg Raw Powder CAS Number 2259884-03-0 Door To Door Service..-Detailed Image 7 Shop Mazdutide 10mg Raw Powder CAS Number 2259884-03-0 Door To Door Service..-Detailed Image 8 Shop Mazdutide 10mg Raw Powder CAS Number 2259884-03-0 Door To Door Service..-Detailed Image 9 Shop Mazdutide 10mg Raw Powder CAS Number 2259884-03-0 Door To Door Service..-Detailed Image 10

                                                  Peptide classification                           

    Peptides are mainly classified based on their molecular structure into large molecule polypeptides, small molecule oligopeptides, as well as dipeptides and tripeptides. According to their application directions, they can be further divided into two categories: cosmetic peptides and health-promoting active peptides.
    Health-promoting active peptides can be rapidly absorbed by the digestive system and participate in body metabolism. They can repair body cells, regulate immunity, alleviate fatigue and weakness, and also regulate blood sugar and lipid levels, nourish the stomach and intestines, repair the mucosa, slow down the aging of body functions, and are suitable for the daily treatment of people with sub-health conditions.
    The cosmetic peptides are mainly used in the field of skin care. Common ones include copper peptides and signal peptides, etc. They can stimulate the production of collagen, reduce fine lines, tighten the skin, repair the damaged barrier, improve redness, reduce skin laxity, and delay facial aging.
    There are also functional peptides, including fat-reducing peptides and anti-aging peptides, which can regulate fat metabolism, inhibit the accumulation of excess fat, and improve body bloating.
    The small molecule form does not require secondary decomposition and has a higher absorption efficiency than proteins. When taken orally daily, it can regulate the body, and when used externally, it can improve skin quality. By consistently supplementing, it can maintain a youthful state from within and is suitable for body and skin care for people of different age groups.

    Shop Mazdutide 10mg Raw Powder CAS Number 2259884-03-0 Door To Door Service..-Detailed Image 11

    Peptide active raw materials and finished products are highly sensitive to temperature. They need to be stored in a refrigerated environment at 2-8℃, and should not be left at room temperature for a long time. Avoid exposing them to high temperatures as it can cause the peptide molecules to denature and result in a decrease in activity, thereby directly affecting the efficacy of the product.
    During daily storage in the warehouse, it is necessary to maintain stable temperature control. Avoid direct sunlight and humid environments. After opening, they should still be refrigerated and used up as soon as possible.
    For goods transportation, priority should be given to using cold storage boxes and cold chain logistics. Place ice packs in the box to maintain low temperature. Try to shorten the transfer time as much as possible and reduce loading and unloadingtime. In hot weather, ordinary express delivery is strictly prohibited. When receiving the goods, promptly check the temperature. If there is an abnormal increase in temperature, the peptide activity will be damaged. It is not recommended to continue using it, in order to ensure the stability of product quality.

    Shop Mazdutide 10mg Raw Powder CAS Number 2259884-03-0 Door To Door Service..-Detailed Image 12 Shop Mazdutide 10mg Raw Powder CAS Number 2259884-03-0 Door To Door Service..-Detailed Image 13

                                                                                                                          Why choose us
    1. Well-equipped, stable and high-quality raw material supply chain, to provide customers with the best quality products.
    2. Strict quality inspection process and professional certificate testing to ensure the quality level of the final product.

    3. Excellent sales team can provide customers with integrated and professional services.

    4. Accept various OEM & ODM services to meet the different needs of different customers,low MOQ.

    5. Professional supplier and manufacturer, an integrated enterprise integrating production and sales, providing customers with one-stop service.
    FAQ

    1. Do you accept customization?
    RE: We can provide corresponding customized solutions according to the specific needs of customers.

    2. Can you provide samples?

    RE: We can provide samples to customers and send them to consumers in time by express.

    3. How is your production capacity ?and whether it can meet customer needs in a timely manner. RE:we can produce the products required by customers in time and have sufficient production capacity.

    4. How long is your lead time?

    RE: Within 50kg, can be shipped within 5 days. More than 50 kg, the corresponding time needs to be negotiated according to the weight of the product.

    5. What is your terms of payment ?

    RE: Payment<=1000USD, 100% in advance. Payment>=1000USD, 50% T/T in advance ,balance before shipment. irrevocable LC at sight.

    6. Do you have OEM or ODM service of product?

    Re: Sure. If needed, we can customize products for you.

    7. How can you guarantee the goods you offer is qualified ?

    Re: All the goods are inspected before shipment. If the goods can't come to the quality we promise, you can ask for refund.

    8.How will you deliver the goods?
    RE:We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS, China Air Post. For container products, we can do sea shipping. You also can choose your own shipping forwarder.
    Company Profile


    LC600 10ml x 600mg/ml/vial
    specification 10 bottles per box
    unit of measurement mg
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    China Factory Direct Supply 5-Amino-1MQ Lyophilized Powder Used to Preserve Muscle, CAS No.: 42464-96-0.... is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • China Factory Direct Supply 5-Amino-1MQ Lyophilized Powder Used to Preserve Muscle, CAS No.: 42464-96-0.... Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,Survodutide,GHK-CU,GLOW,KLOW

    Location:

    Building 1, Floor 2, No. 96 Banhe Road, Huangpu District, Guangzhou City, Room 2164

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    12

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2026

    Certifications:

    COA,COA,COA,COA,COA,COA,COA,COA,COA

    Company Profile of Guangzhou Henghuang Trading Co., Ltd.
    Guangzhou Henghuang Trading Co., Ltd. specializes in the field of bioactive peptides. It integrates the supply of high-end peptide raw materials, the output of freeze-dried powder products, and personalized customized production. Based in the Guangdong-Hong Kong-Macao Greater Bay Area, it strives to provide high-standard raw materials and OEM solutions for the beauty and health industries, and empowers brand long-term development with cutting-edge biotechnology.
    The company strictly selects high-quality peptide raw materials, covering a full range of categories such as cosmetic peptides and functional active peptides. The purity of the raw materials strictly complies with the advanced industry standards, and the molecular activity is stable, meeting the diverse needs of product development. The freeze-dried powder is processed through a low-temperature vacuum freeze-drying process, which locks the activity of effective substances to the greatest extent. The quality is stable and suitable for various application scenarios such as hospital-line skincare, daily care products, and health derivatives. We deeply integrate upstream supply chain resources and collaborate with standardized production workshops. We can undertake the full chain services of formula development, formulation blending, specification customization, and packaging outsourcing, flexibly matching batch purchases and niche exclusive customization to meet the differentiated layout of customers.
    The enterprise strictly adheres to strict quality control standards, conducting rigorous verification at every step, from raw material entry, sample testing to product delivery. It firmly maintains the quality bottom line of safety and compliance. With the business philosophy of "craftsmanship for the long term, creating win-win outcomes", it relies on a mature supply chain system and technical service capabilities, while also considering product quality, delivery efficiency and cost advantages.
    Focusing on the market, Henghuang Trading adheres to a high-end positioning, deeply delving into the peptide raw materials and freeze-dried powder sectors, and continuously iterating the raw material categories and production processes. With stable supply, flexible customization, and professional technical support, it serves overseas and domestic cooperative merchants, collaborates with partners to deeply explore the efficacy market, builds a high-quality peptide industry ecosystem, and creates a reliable raw material and customization service provider in the industry.

    ">
  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.