Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Abrasive > LL-37 for Sale > LL37 GHK-CU NAD+ 375 CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Recombinant peptide
LL37 GHK-CU NAD+ 375 CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Recombinant peptide buy - large image1
LL37 GHK-CU NAD+ 375 CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Recombinant peptide buy - image1
LL37 GHK-CU NAD+ 375 CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Recombinant peptide buy - image2
LL37 GHK-CU NAD+ 375 CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Recombinant peptide buy - image3
LL37 GHK-CU NAD+ 375 CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Recombinant peptide buy - image4
LL37 GHK-CU NAD+ 375 CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Recombinant peptide buy - image5
LL37 GHK-CU NAD+ 375 CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Recombinant peptide buy - image6

LL37 GHK-CU NAD+ 375 CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Recombinant peptide

TDS 1 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

5mg/50mg/ 100mg/ 500 mg/ 1000 mg. 10 bottles per box. 10 bottles per box

Price valid (until):

2027-10-31

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


       Product Detail  



    Sales manager: Sofia

    WhatsApp:+85244569741

    Sincerely look forward to your inquiries about our products.

    Benefits

    1. Weight loss plan using slimming peptides to improve body composition

    2.Efficient weight loss and blood sugar control: Breakthrough data reshapes treatment standards;

    3. Comprehensively improve metabolic health: Covering the risks of liver, cardiovascular and respiratory system diseases;

    4. Optimize the treatment experience: Innovative dosage forms can enhance compliance and reduce operational burdens;

    5. Long-term health management: Preventing complications and providing payment support can alleviate the burden brought by diseases.

    Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 Tirzepatide CAS910463-68-2 Equitable price-Detailed Image 1

    Our Advantages

    1.We have more than 10 years of experience in the field of chemical industry, the company's products are exported to more than 60 countries overseas, of which 80% are exported to Europe and America, 20% are exported to Southeast Asia, the Middle East, South Africa and other regions.


    2.We have our own production plant and R & D center, to provide customers with technical support, product customization, free recipes and other whole industry chain services. Support full video inspection, testing, global delivery package.


    3.We accept sample orders for testing, after purchasing products from our factory, we have a professional technical team and after-sales team to serve you and solve all your future problems. 100% quality assurance, 100% safe delivery.

    Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 Tirzepatide CAS910463-68-2 Equitable price-Detailed Image 2

    Peptide produc ts offer diverse functional benefits across multiple scenarios:

    in health management, peptides support metabolic regulation (aiding in blood sugar control and healthy weight management for specific groups) and immune system modulation by enhancing the body's defense responses;

    in skincare, peptides promote skin barrier repair, boost collagen synthesis to reduce fine lines, and improve skin hydration and elasticity;

    in sports nutrition, peptides assist in muscle recovery by reducing post-exercise tissue damage and supporting muscle protein synthesis.

    Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 Tirzepatide CAS910463-68-2 Equitable price-Detailed Image 3

    FAQ

    Q: Could you please tell me about the lifespan or durability of this product?

    A: The specific usage period of the product mainly depends on the actual usage volume and frequency of the customer.

    Q: How much experience and reputation does your company have in the industry?

    A: Our company has many years of operating experience in the industry and is renowned for its excellent product quality and high-quality customer service. We enjoy a good reputation in the industry and have a group of loyal customers who have been cooperating with us for a long time.

    Q: What are your company's return and refund policies?

    A: We have a flexible and customer-oriented return and refund policy. If the goods are damaged during transportation, we will provide a full refund or a free replacement to fully protect the rights and satisfaction of the customers.


    Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 CAS910463-68-2 TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60-Detailed Image 4

    Fast and safe delivery.

    1)Secure and discreet shipment various transportation methods for your choice.

    2)Customs pass rate >99%.

    We have clients throughout the world.

    3)Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.

    4)Market feedback and goods feedback will be appreciated, meeting customers' requirement is our principal responsibility.

    5)High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.


    Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 Tirzepatide CAS910463-68-2 Equitable price-Detailed Image 5 Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 Tirzepatide CAS910463-68-2 Equitable price-Detailed Image 6 Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 Tirzepatide CAS910463-68-2 Equitable price-Detailed Image 7 Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 Tirzepatide CAS910463-68-2 Equitable price-Detailed Image 8

    Our factory

    We have many years of trading experience and are professional Chemical raw materials, medicine, Pharmaceutical raw material suppliers in overseas . Hope to cooperate with you for a long time and achieve win-win purpose. Our experienced staff is committed to strict quality control and attentive customer service and is always available to discuss your requirements and ensure complete customer satisfaction. Our company firmly believes that all products must comply with international quality standards. We therefore focus on sourcing quality materials and ensuring strict internal process controls. Our professional inspectors ensure that the products delivered to our customers are perfect. Our company adhere to the "customer first, reputation assurance, quality assurance, professional service" policy. No matter what type of product you need, you can contact us at any time, we will provide high quality products in the fastest and best way to achieve customer satisfaction. In addition, we will provide the best service to our customers. We look forward to establishing long-term business relations with overseas on the basis of mutual benefit in the near future. If you are interested in our products or companies, please feel free to contact us for more details!

    Shop Retatrutide China factory peptides Manufacturer's price Ensure safe delivery-Detailed Image 10

    Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 CAS910463-68-2 TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60-Detailed Image 10

    Shipping

    Shop Semaglutide SM2 SM5 SM10 SM15 SM20 SM30 CAS910463-68-2 TR5 TR10 TR15 TR20 TR30 TR40 TR50 TR60-Detailed Image 11

    Shop Retatrutide China factory peptides Manufacturer's price Ensure safe delivery-Detailed Image 12

    Welcome to be our distinguished customer,please do not hesitate to contact us!

    Certificates
    • LL37 GHK-CU NAD+ 375 CU50 CU100 NJ100 NJ500 NJ1000 CAS154947-66-7 Recombinant peptide Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Abrasive

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    20 years of production experience in peptide products

    Safe and unobstructed shipping channels|High quality guaranteed|

    Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.


  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.