Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > S961 99% High peptide content white powder GLP/GLP-1 5mg 10mg 30mg customization
S961 99% High peptide content white powder GLP/GLP-1 5mg 10mg 30mg  customization buy - large image1
S961 99% High peptide content white powder GLP/GLP-1 5mg 10mg 30mg  customization buy - image1
S961 99% High peptide content white powder GLP/GLP-1 5mg 10mg 30mg  customization buy - image2
S961 99% High peptide content white powder GLP/GLP-1 5mg 10mg 30mg  customization buy - image3
S961 99% High peptide content white powder GLP/GLP-1 5mg 10mg 30mg  customization buy - image4
S961 99% High peptide content white powder GLP/GLP-1 5mg 10mg 30mg  customization buy - image5
S961 99% High peptide content white powder GLP/GLP-1 5mg 10mg 30mg  customization buy - image6

S961 99% High peptide content white powder GLP/GLP-1 5mg 10mg 30mg customization

COA

Unit Price:

$10-13/G FOB

Get Latest Price
CAS No.:

1083433-49-1

Grade:

Industrial Grade

Content:

99%

Port:

shenzhen

Brand:

Customizable

Packaging:

5MG 10MG 20MG 30MG 60MG---1G 100G 1KG

Price valid (until):

2026-08-10

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,Semaglutide,Cagrilintide

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    Product Name:S961

    CAS No.:1083433-49-1

    Purity (HPLC) ≥99.0%

    Single impurity≤1%

    Peptide content≥80.0%

    Amino Acid Composition≤±15%

    Bacterial Endotoxins≤5EU/mg

    Vacuum-packed with aluminum foil bag or penicillin bottle. 10mg,50mg,100mg,1g,10g, 50g per package with icebag. Or according to your request.

    Tirzepatide (Tirzepatide, Telapomatide) is a dual agonist of glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptors, and is being developed for the treatm

    Storage:Cool dry place( Store at -20°C, away from the light)

    Remark:For Research Use Only. Not for human use.

    Items Specifications
    S961 5MG 10MG 20MG 30MG 60MG---1G 100G 1KG





    Company Profile  

    Company Name: Sichuan HanTong KunTai Biotechnology Co., Ltd.
    Company Email: hantongkuntai@foxmail.com
    Mobile Phone: 18981903347

    WhatsApp:+852 9207 6974
    Company Establishment Date: March 18, 2025
    Website: hantongkuntai.myaipages.com
    Address: Qingbaijiang District, Qingbaijiang Avenue 2888, Chengdu, Sichuan Province
    Company Slogan: All great drugs, initially, await a correct connection

    Company Profile:Regarding us
    Sichuan Han Tong Kun Tai was established in 2025. The company focuses on high-value-added products in the pharmaceutical industry, such as advanced pharmaceutical intermediates, raw materials, and preparations for international trade. It also makes continuous investments in the field of green chemistry, aiming to provide one-stop solutions for the global pharmaceutical industry.


    Shop S961 99% High peptide content white powder GLP/GLP-1 5mg 10mg 30mg  customization-Detailed Image 1

    Q1: May I get one sample before placing an order?
    Yes, samples are available, and the specific policy varies by product type and customer cooperation status:
    1. For regular products, samples are free of charge. You only need to cover the freight cost.
    2. For high-value products, you need to bear both the freight cost and a certain percentage of the product cost.
    3. For long-term cooperative customers or our VIP customers, free samples will be provided whenever you need them.

    ---

    Q2: Which payment methods are available for your company?
    We support multiple mainstream payment methods for your convenience, including but not limited to:
    - T/T (Telegraphic Transfer)
    - PayPal
    - Bank Transfer

    You can choose the one that best suits your needs and regional payment habits.

    ---

    Q3: How and when can I get my goods after payment?
    The delivery method and arrival time depend on your order quantity:
    1. **Small-quantity orders**
    - Delivery methods: International couriers (DHL, FedEx, TNT, etc.) or air freight.
    - Arrival time: Usually 5-7 days after the goods are dispatched.
    2. **Large-quantity orders**
    - Recommended delivery method: Sea freight (more cost-effective for bulk goods).
    - Arrival time: 15-30 days to reach your destination port, which varies depending on the port location.

    ---

    Q4: Is it possible to use my appointed label or package?
    Yes, we fully support the use of your appointed labels or packaging to meet your brand positioning and marketing needs. The cooperation process is as follows:
    1. Provide materials: Please share clear design files (e.g., AI, PDF with vector graphics) or physical samples of your labels/packaging. This helps us verify if they comply with international shipping standards and product protection requirements.
    2. Evaluate and confirm: We will assess the compatibility of your customized packaging with our production lines. If special materials or complex printing processes are required, a small additional fee may apply, and we will confirm the exact amount with you in advance.
    3. Sample approval: Before mass production, we will produce a sample of the product with your customized labels/packaging for your final confirmation. Full-scale production and delivery will only start after you approve the sample.

    Certificates

    Basic Info
    Product Name:

    GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY trifluoroacetate salt

    CAS No.:

    1083433-49-1

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,Semaglutide,Cagrilintide

    Location:

    No.2888 Sichuan Qingbaijiang Avenue

    Average lead Time:

    7

    Year of Establishment:

    2025

    Certifications:

    contact,contract

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.