Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 CAS 154947-66-7 factory directly
LL37 CAS 154947-66-7  factory directly buy - large image1
LL37 CAS 154947-66-7  factory directly buy - image1
LL37 CAS 154947-66-7  factory directly buy - image2
LL37 CAS 154947-66-7  factory directly buy - image3
LL37 CAS 154947-66-7  factory directly buy - image4
LL37 CAS 154947-66-7  factory directly buy - image5
LL37 CAS 154947-66-7  factory directly buy - image6

LL37 CAS 154947-66-7 factory directly

COA 1 Inquiries

Unit Price:

$40-45/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

china

Brand:

Beautide

Packaging:

10mg*10vials

Price valid (until):

2026-08-13

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide Products

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


       Product Detail  


    WA: +852 6225 9164
    Tele: +852 6230 1937
    graceskincare02@outlook.com


    Formal Name P21(P021)
    Specification 5mg*10vials
    Purity 99.0%+
    Payment Method Wise, USDT, USDC, Bitcoin or Bank transfer


    Shop Weight loss Semaglutide Lyophilized peptide power CAS910463-68-2-Detailed Image 1 Shop Weight loss Semaglutide Lyophilized peptide power CAS910463-68-2-Detailed Image 2

    Company Profile

    We specialize in a wide range of high-quality chemical products, including organic intermediates, cosmetic raw materials, chemical reagents, dye intermediates, synthetic material intermediates, industrial chemicals, and more.

    With over 200+ product categories, we are committed to providing stable, reliable, and cost-effective solutions for global partners across various industries.

    ✔️ Consistent Quality You Can Rely On

    Backed by advanced production equipment, strong technical capabilities, and a strict quality control system, we ensure every batch meets stable and reliable standards. Our experienced technical team and scientific management system guarantee consistent product performance.

    ✔️ High Efficiency & Reliable Supply Chain

    We maintain a high product pass rate and efficient production system, ensuring fast response and stable supply for both bulk and smallorders.

    ✔️ Global Shipping Support

    We offer flexible and secure logistics solutions via DHL, UPS, FedEx, and other professional freight partners, ensuring safe and timely delivery worldwide.

    ✔️ Flexible Cooperation

    We support small trial orders and long-term partnerships. Whether you are a distributor, wholesaler, or manufacturer, we are ready to support your business growth.

    👉 Let’s Build Long-Term Cooperation

    We believe in “Premium Quality, Reliable Service, and Sustainable Partnership.”
    Contact us today to discuss your requirements and explore business opportunities together.

    Shop Retatrutide-Lyophilized Peptide Powder Retatrutided Peptide-Detailed Image 3

    Our Service

    1. We reply to all customer messages within 24 working hours.

    2. We support custom design and OEM services for your unique needs.

    3. We use high-quality raw materials, modern equipment and standard production processes to guarantee stable and good product quality.

    4. We are a professional manufacturer with over 15 years of experience in bio-ingredient production, providing stable quality and favorable prices.

    Our Technology

    Using advanced freeze-drying and cryogenic preservation techniques, all raw materials are stored under strict ultra-low temperature conditions to ensure maximum stability and preserved biological activity throughout production and storage.

    Each product is designed for convenient use—simply reconstitute the lyophilized powder with the appropriate sterile solvent before application, restoring consistent and reliable biological performance.


    Shop Retatrutide-Lyophilized Peptide Powder Retatrutided Peptide-Detailed Image 4 Shop Retatrutide-Lyophilized Peptide Powder Retatrutided Peptide-Detailed Image 5

    FAQ

    Q1: What's your MOQ?

    A:Except for customized products, the MOQ for most items is one box.


    Q2: How about delivery leadtime?

    A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)


    Q3: Is there a discount?

    A:Different quantity has different discount.


    Q4: How to start orders or make payments?

    A:Payment by Wise, USDT, USDC, Bitcoin or Bank transfer.


    Q5: How do you treat quality complaint?

    A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.


    Q6:Do you test all your goods before delivery?

    A:Yes, we have 100% test before delivery,International Authorized Third-Party Test for the products if you need are highly welcomed.

    Shop Retatrutide-Lyophilized Peptide Powder Retatrutided Peptide-Detailed Image 6 Shop Weight loss Semaglutide Lyophilized peptide power CAS910463-68-2-Detailed Image 5

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide Products

    Location:

    Unit 1262, Room 103, Building Jia-19, Jixiangyuan, Tongzhou District, Beijing

    Payment Terms:

    100% TT in advance

    Average lead Time:

    15

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    11-50

    Year of Establishment:

    2026


      Company Profile  


    Beijing Beautide Co., Ltd is a specialized enterprise engaged in the research, manufacturing and global distribution of cosmetic functional raw materials, with core product lines covering synthetic peptides, biotech active substances and skincare raw materials.
    The company operates standardized production facilities and independent quality testing laboratories. A full-range quality management system is implemented throughout the entire production workflow, covering raw material incoming inspection, production process monitoring and finished product testing. All products comply with domestic cosmetic safety specifications and relevant international export regulatory standards.
    Our primary business covers bulk raw material supply, customized formula development, OEM & ODM technical support, as well as export compliance consultation for cosmetic manufacturers worldwide. We have established long-term stable cooperative partnerships with clients from Asia, Europe and all over the world.
    Supported by an in-house professional R&D team, we continuously develop mild, stable and market-adaptable active ingredients. The company prioritizes product consistency, traceable quality and transparent technical communication, and delivers standardized, cost-effective raw material solutions to global cosmetic brands and processing factories.
    Upholding the operation tenet of compliance, stability and sustainable cooperation, the company focuses on practical technical services and reliable product supply, and maintains objective and standardized product descriptions for all export markets.
    If you have purchasing needs or require more technical details regarding purity, specifications, or logistics, please feel free to contact us. We look forward to building long-term cooperation and delivering mutual value through reliable supply and professional service.
  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.