Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > 375 Factory direct sale. 99% pure, high quality, fast and safe delivery,./,peptide
375 Factory direct sale. 99% pure, high quality, fast and safe delivery,./,peptide buy - large image1
375 Factory direct sale. 99% pure, high quality, fast and safe delivery,./,peptide buy - image1
375 Factory direct sale. 99% pure, high quality, fast and safe delivery,./,peptide buy - image2
375 Factory direct sale. 99% pure, high quality, fast and safe delivery,./,peptide buy - image3
375 Factory direct sale. 99% pure, high quality, fast and safe delivery,./,peptide buy - image4
375 Factory direct sale. 99% pure, high quality, fast and safe delivery,./,peptide buy - image5
375 Factory direct sale. 99% pure, high quality, fast and safe delivery,./,peptide buy - image6

375 Factory direct sale. 99% pure, high quality, fast and safe delivery,./,peptide

TDS 1 Inquiries

Unit Price:

$100/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.97%

Port:

HONGKONG

Brand:

Customization Available

Packaging:

5mg*10vials/box

Price valid (until):

2026-08-15

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,GHK-CU,KPV,MOTS-C,KLOW80

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Pls input...

    contact information

    Name : 

    Email address : 1712164275@qq.com

    Whatsapp:+85244974695

    Telegram : +1712164275@qq.com


    .

    1. Ultra-High Purity
                             Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.


                     2.Accurate Dosing & Consistency
                              Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.


                     3.Endotoxin-Free & Sterile Processing
                              Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.


    Items Specifications
    Model NO. Retatrutide
    Quality Pharmaceutical 
    Appearance White powder

    Peptide

    Peptide products offer diverse functional benefits across multiple scenarios:

    in health management, peptides support metabolic regulation (aiding in blood sugar control and healthy weight management for specific groups) and immune system modulation by enhancing the body's defense responses; 

    in skincare, peptides promote skin barrier repair, boost collagen synthesis to reduce fine lines, and improve skin hydration and elasticity; 

    in sports nutrition, peptides assist in muscle recovery by reducing post-exercise tissue damage and supporting muscle protein synthesis.

    Why Choose Our Peptides?

    • Clinically Relevant: Aligns with global trends in peptide therapeutics, a market projected to reach $83.75B by 2034 .
    • Quality Assured: Sourced from trusted manufacturers with reliable global distribution, ensuring consistency and potency .
    • Holistic Support: Complements weight management programs, metabolic health goals, and sleep apnea treatment plans—addressing root causes for lasting impact .

    Key Search Terms:

    Prescription peptide for weight loss, obesity peptide therapy, OSA treatment peptides, high-purity weight loss peptides, custom peptides formulations, GLP-1 related peptides,  peptide for weight management, peptide supplements for metabolic health
    Customizable peptide
    Skin care peptide
    Beauty peptide
    Muscle building peptide
    Hair growth peptide
    Weight loss peptide
    Fitness peptide


    Compan

    Henghong Trading Co., Ltd.LTD was established in 1999 with strong research and development capabilities and superb synthesis technology, as well as advanced quality control measures. Effectively promote the joint venture and cooperation with the major enterprises, manufacturers, with the idea of industrial development to serve the society and the majority of users. We always adhere to the market demand as the orientation, constantly synthesizing new high-tech chemical products and medical intermediates.

    We always put the value of our customers as our top priority, we focus on high quality, competitive price, flexible order quantity, timely delivery. Our products are mainly exported to European countries, the United Kingdom, the United States, Canada and Australia. Our products are widely recognized and trusted by users.

    We have our own delivery line to Canada, USA, UK, Spain, Poland, Netherland, Germany, Russia, Kazakhstan, Ukraine, etc. Door to door without any customs clearance iss



    Shop Customization Available Cosmetic Powder GhkCU Peptide Peptide  100mg CAS 49557-75-7 Anti-aging Peptides-Detailed Image 1
    Shop Customization Available Cosmetic Powder GhkCU Peptide Peptide  100mg CAS 49557-75-7 Anti-aging Peptides-Detailed Image 2
    Shop Customization Available Cosmetic Powder GhkCU Peptide Peptide  100mg CAS 49557-75-7 Anti-aging Peptides-Detailed Image 3
    Shop Customization Available Cosmetic Powder GhkCU Peptide Peptide  100mg CAS 49557-75-7 Anti-aging Peptides-Detailed Image 4
    Shop Customization Available Cosmetic Powder GhkCU Peptide Peptide  100mg CAS 49557-75-7 Anti-aging Peptides-Detailed Image 5
    Shop Customization Available Cosmetic Powder GhkCU Peptide Peptide  100mg CAS 49557-75-7 Anti-aging Peptides-Detailed Image 6
    Shop Customization Available Cosmetic Powder GhkCU Peptide Peptide  100mg CAS 49557-75-7 Anti-aging Peptides-Detailed Image 7
    Shop Customization Available Cosmetic Powder GhkCU Peptide Peptide  100mg CAS 49557-75-7 Anti-aging Peptides-Detailed Image 8
    Shop 375 Factory direct sale. 99% pure, high quality, fast and safe delivery,./,peptide-Detailed Image 9
    Shop 375 Factory direct sale. 99% pure, high quality, fast and safe delivery,./,peptide-Detailed Image 10
    Shop 375 Factory direct sale. 99% pure, high quality, fast and safe delivery,./,peptide-Detailed Image 11
    Shop 375 Factory direct sale. 99% pure, high quality, fast and safe delivery,./,peptide-Detailed Image 12
    Shop 375 Factory direct sale. 99% pure, high quality, fast and safe delivery,./,peptide-Detailed Image 13
    Shop 375 Factory direct sale. 99% pure, high quality, fast and safe delivery,./,peptide-Detailed Image 14
    ABOUT US

    We are a chemical manufacturer integrating production, processing and export, mainly dealing in pharmaceutical intermediates and various industrial chemicals. Since its establishment, the company adheres to the spirit of "integrity management, strict quality control, customer first", and has won praise from customers at home and abroad. We have also established an excellent professional sales team with rich international marketing experience, able to efficiently provide a range of products and professional services.


                  With synthetic biology platform technology as the core, it conducts innovative research and development, mainly engaged in the research and development of recombinantly expressed pharmaceutical peptides and proteins. Its products include innovative drugs, APIs, pharmaceutical and green synthetic industrial enzymes, functional peptides and protein products, etc.


                   At present, our company has realized the industrialization of a variety of biosynthetic peptide products and has obtained cooperation orders from many well-known domestic and foreign pharmaceutical companies.

    Certificates
    • 375 Factory direct sale. 99% pure, high quality, fast and safe delivery,./,peptide Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,GHK-CU,KPV,MOTS-C,KLOW80

    Location:

    2nd Floor, Room 0996, No. 963 Tianyuan Road, Tianhe District, Guangzhou

    Average lead Time:

    5

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    51-100

    Year of Establishment:

    2026

                   Company Profile

    Henghong Peptides is a biotechnology enterprise serving global markets, focusing on synthetic peptides. With mature peptide synthesis and purification technology, we have built a comprehensive product portfolio, including KPV, GHK‑CU and other bioactive peptides, as well as BAC Water bacteriostatic solvent, widely used in bioscience research.
    We implement strict quality control. Every batch undergoes purity testing to ensure consistent quality. We offer diversified packaging solutions including bulk raw material and vial filling, supporting small trial orders and mass bulk supply.
    Our products are exported to Europe, America, Southeast Asia and other regions. Supported by mature cross-border logistics, we guarantee efficient delivery. Adhering to integrity and win-win cooperation, we provide stable, cost-effective peptide raw materials and professional supporting services for global partners.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.